(data stored in ACNUC9435 zone)

EMBL: CP000904.PE163

CP000904.PE163       Location/Qualifiers
FT   CDS             complement(241568..246124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5619"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2452 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5619"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46587"
FT                   /db_xref="GOA:A9VUL6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL6"
FT                   /protein_id="ABY46587.1"
FT                   /translation="MANEECYPLSHPQRRIWYTEVIHSGKGICNLRFLFKLHRKMDYSK
FT                   LNRVVNRVISENDGLCIRLKENGHQEPEQYFIKHEEQEFEFFDFSSVEDSDLLEKWIEQ
FT                   KTKETFTLFNSDLYYFALIKLNDNECAVFGNVHHIIMDGLSIQIFTSQIAKYYYEMHNE
FT                   TEEGEIRNSYVQFLANEQTYLNSIRFQKDQKFWLEEFKTIPSVTGLKPYNTYQVSTKAS
FT                   RETFILSEHLKRKIELFSDDYKLSVYSLFVAAFSLSMCRWTSSLDIALGMAYGNRMTKT
FT                   ERELIGMMVSTVPLRMDIDPEEEVLSFIGRVSRKQSKSLRHQKYPFDLLLKQINKENNS
FT                   NVRLFGTTIDYRDRDESGDSLWIPNGEEMQDFAVHIENLTDIDSLQVHIDYRKELFSKE
FT                   EINRFFKTMLAVIENTFKNPKQKVSEIEIISEEDKRKSLVEFNNPKLDFPPQVTIHELF
FT                   EQQAMIYPNSIAVTYEKGKVTYRELNEHANQLAHYLQKKGVGPDTLVGLCVERSLEMIV
FT                   GILGILKAGGAYVPLDPTYPEQRLQYILEDAGIQLFVTQESLKELKWLPENIKSICLDR
FT                   DRDEIGQESKTLPFSDVSSQNLAYVIYTSGSTGNPKGVMIEHHNVIRLFKSTDCWYQFN
FT                   EKDTWTLFHSYAFDFSVWEIWGALLYGGKLVVVPYLISRSPKDFYQLLVEEEVSVLNQT
FT                   PSAFRQLIQVCEQEDENKNLNLRYVIFGGEALEPISLLPWFQRYGEKEPQLINMYGITE
FT                   TTVHVTYYPITQDDVRHASRSNIGKRIPDLEVYILDAYQQPVPIGVEGELYIGGAGLAR
FT                   GYLNRPELTAERFIPHPFSSDPKARLYRTGDLARYLPDGNLDYRGRIDHQVKIRGFRIE
FT                   IGEIESTINAYASIKEAVVIVREDQPGDKRLVAYVVGDGNVGAWREYLKTKLPSYMVPS
FT                   RFVTMEAIPLTANGKVDREVLPMPEEEQTNSEAVAPRNSNEKILATIWKQVLGVKKVGI
FT                   HDNFFEIGGDSILSIQIIFQASQEGLKLTPKQMFECPTIAELAQVAIETQGVQAEQGIV
FT                   TGEVPLTPIQYWFFEQEHSRPEHWNQSMLLRVKERLDVKLLEGAILNLLKHHDALRFRY
FT                   EQLPNGTWRQRNEGTDEHSVLHVVKRNKANEQAWNKVIQEEMNITQTSFNLVTGPLMRV
FT                   VYFEDTLSGNDRIFWVIHHLVVDGVSWRILLEDLQAVYNQMKQGQGVRLPAKSTSFKEW
FT                   SERLQAYSDSGISKEVQDYWNERVEKETMKIPMDYPMQETTEESIDQVTRTLGVEETHA
FT                   LLQEVPVTHKTRINEVLLAALGQAIVDFTNEQTVSIHLEGHGREEMVEGIDLSRTVGWF
FT                   TSIYPVHLNFQGTKTPIEGLKAVKDQLRQIPNRGVDYGILRYLKKELLPFYQQKPSISF
FT                   NYLGQFDQVFSKESLFMQETGFTFLDHAPDSKPSHLIDVIGMVKDKKLHFVWMYSREQF
FT                   SRLKIQAIADGMLRHLRQLINKPTTESAFTVSDFADAEDLTEESLSKVLLKLTKKRV"
     MANEECYPLS HPQRRIWYTE VIHSGKGICN LRFLFKLHRK MDYSKLNRVV NRVISENDGL        60
     CIRLKENGHQ EPEQYFIKHE EQEFEFFDFS SVEDSDLLEK WIEQKTKETF TLFNSDLYYF       120
     ALIKLNDNEC AVFGNVHHII MDGLSIQIFT SQIAKYYYEM HNETEEGEIR NSYVQFLANE       180
     QTYLNSIRFQ KDQKFWLEEF KTIPSVTGLK PYNTYQVSTK ASRETFILSE HLKRKIELFS       240
     DDYKLSVYSL FVAAFSLSMC RWTSSLDIAL GMAYGNRMTK TERELIGMMV STVPLRMDID       300
     PEEEVLSFIG RVSRKQSKSL RHQKYPFDLL LKQINKENNS NVRLFGTTID YRDRDESGDS       360
     LWIPNGEEMQ DFAVHIENLT DIDSLQVHID YRKELFSKEE INRFFKTMLA VIENTFKNPK       420
     QKVSEIEIIS EEDKRKSLVE FNNPKLDFPP QVTIHELFEQ QAMIYPNSIA VTYEKGKVTY       480
     RELNEHANQL AHYLQKKGVG PDTLVGLCVE RSLEMIVGIL GILKAGGAYV PLDPTYPEQR       540
     LQYILEDAGI QLFVTQESLK ELKWLPENIK SICLDRDRDE IGQESKTLPF SDVSSQNLAY       600
     VIYTSGSTGN PKGVMIEHHN VIRLFKSTDC WYQFNEKDTW TLFHSYAFDF SVWEIWGALL       660
     YGGKLVVVPY LISRSPKDFY QLLVEEEVSV LNQTPSAFRQ LIQVCEQEDE NKNLNLRYVI       720
     FGGEALEPIS LLPWFQRYGE KEPQLINMYG ITETTVHVTY YPITQDDVRH ASRSNIGKRI       780
     PDLEVYILDA YQQPVPIGVE GELYIGGAGL ARGYLNRPEL TAERFIPHPF SSDPKARLYR       840
     TGDLARYLPD GNLDYRGRID HQVKIRGFRI EIGEIESTIN AYASIKEAVV IVREDQPGDK       900
     RLVAYVVGDG NVGAWREYLK TKLPSYMVPS RFVTMEAIPL TANGKVDREV LPMPEEEQTN       960
     SEAVAPRNSN EKILATIWKQ VLGVKKVGIH DNFFEIGGDS ILSIQIIFQA SQEGLKLTPK      1020
     QMFECPTIAE LAQVAIETQG VQAEQGIVTG EVPLTPIQYW FFEQEHSRPE HWNQSMLLRV      1080
     KERLDVKLLE GAILNLLKHH DALRFRYEQL PNGTWRQRNE GTDEHSVLHV VKRNKANEQA      1140
     WNKVIQEEMN ITQTSFNLVT GPLMRVVYFE DTLSGNDRIF WVIHHLVVDG VSWRILLEDL      1200
     QAVYNQMKQG QGVRLPAKST SFKEWSERLQ AYSDSGISKE VQDYWNERVE KETMKIPMDY      1260
     PMQETTEESI DQVTRTLGVE ETHALLQEVP VTHKTRINEV LLAALGQAIV DFTNEQTVSI      1320
     HLEGHGREEM VEGIDLSRTV GWFTSIYPVH LNFQGTKTPI EGLKAVKDQL RQIPNRGVDY      1380
     GILRYLKKEL LPFYQQKPSI SFNYLGQFDQ VFSKESLFMQ ETGFTFLDHA PDSKPSHLID      1440
     VIGMVKDKKL HFVWMYSREQ FSRLKIQAIA DGMLRHLRQL INKPTTESAF TVSDFADAED      1500
     LTEESLSKVL LKLTKKRV                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page