(data stored in ACNUC9435 zone)

EMBL: CP000904.PE164

CP000904.PE164       Location/Qualifiers
FT   CDS             complement(246139..247401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5620"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bce:BC2450 macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46588"
FT                   /db_xref="GOA:A9VUL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL7"
FT                   /protein_id="ABY46588.1"
FT                   /translation="MKTTESKSLWGNTIYLQVFSAYSLLMLGVFIDMLAIMTIVSFEWE
FT                   VDPTMIGLIPVAYALPGIIFSSWAGVIADRFRKIPIMMFCNLMVGLLTIVLLFVQTIHW
FT                   LLLALMIRSIFTVFYYPAQQTLTRQIVSPDLLTKAVSINGIVEQGTKILGPLIGGMLLS
FT                   WFQPEFCLIIRAICCLLAALVLLPTIRLQESLSREHIEKKQQSTWTAWLQGWGYVLSNR
FT                   MILSTMIFFTIAMAVLQLVDSQFPTLFKSLFPNDKSKMGYIISIIGLGGIIGAFLTQKL
FT                   KHFQYGWVICGGIALMGIGFGGISLITLINPGASLIFAYLISFIAGIGSGLMLVSNQVI
FT                   LQIESHQEQVGRVFGIQSSLANAVLIISPAMSGPLVHFFGVIELYFYVGIGLIIIGVIG
FT                   VSLQKYIWVKHKQEPIRVNNF"
     MKTTESKSLW GNTIYLQVFS AYSLLMLGVF IDMLAIMTIV SFEWEVDPTM IGLIPVAYAL        60
     PGIIFSSWAG VIADRFRKIP IMMFCNLMVG LLTIVLLFVQ TIHWLLLALM IRSIFTVFYY       120
     PAQQTLTRQI VSPDLLTKAV SINGIVEQGT KILGPLIGGM LLSWFQPEFC LIIRAICCLL       180
     AALVLLPTIR LQESLSREHI EKKQQSTWTA WLQGWGYVLS NRMILSTMIF FTIAMAVLQL       240
     VDSQFPTLFK SLFPNDKSKM GYIISIIGLG GIIGAFLTQK LKHFQYGWVI CGGIALMGIG       300
     FGGISLITLI NPGASLIFAY LISFIAGIGS GLMLVSNQVI LQIESHQEQV GRVFGIQSSL       360
     ANAVLIISPA MSGPLVHFFG VIELYFYVGI GLIIIGVIGV SLQKYIWVKH KQEPIRVNNF       420
//

If you have problems or comments...

PBIL Back to PBIL home page