(data stored in ACNUC9435 zone)

EMBL: CP000904.PE166

CP000904.PE166       Location/Qualifiers
FT   CDS             complement(248760..250742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5622"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: cbh:CLC_2047 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5622"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46590"
FT                   /db_xref="GOA:A9VUL9"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021862"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL9"
FT                   /protein_id="ABY46590.1"
FT                   /translation="MIIQKTRRSFNKVIIITAACSMFSMFGTSISHTKAETHSAAPAVY
FT                   VSPQNIPASDIISIDWSPVQTAPYTYWAVHNWNAGGEAGGYAGFQQQSGFDENGKRTLH
FT                   FAIWDPISSKEAIKAEYLSPNSQAGLFGGEGTGLKVQTTYGWKDYNWYRMTMRSWQEDG
FT                   HTKFGQWMKDVTKNKWHLIAIMDFPVANVAFNHGLGMFQEDWADSGQNVREARLKNGYS
FT                   RKLVDKQWSSWNNQNISGTHDNTYQYDGGATSEYVWVKAGGNTQSTIGSGKIFTLNQPT
FT                   QPEIGKLDFDIQSIYYENEKLNVSWKLKENSTPQFKGKIEIYNNENMTGQPINVIDDIK
FT                   SYQNGISQSISLPTNAYAKIVLTDLFDQTVEKKVQIKNQSPNIFEGNEFAWSLKGIGDF
FT                   EFAKVNLNRSIEEIQIALKAGVPHNYFDSTYASIKVQNTSGKVVYNKEIYGNKQQNAEQ
FT                   VKVPVKVGDFIEFTHLEGANRATITNMEKNIQESFGNKAVYEITKEGLKKVDNIVNPKP
FT                   DTEAPTQPQGLYASNVTSNSIELKWNPSTDNVGVKEYQVLRDGQLIQTVQGTTFTDQNL
FT                   TVNKEYKYAVKAVDAAGNTSIQSDILPVKTKNQNESYEKWDPKKAYTKGDKVEHQGKIY
FT                   EAVQNHQGNGDPNWIFALALWNPLT"
     MIIQKTRRSF NKVIIITAAC SMFSMFGTSI SHTKAETHSA APAVYVSPQN IPASDIISID        60
     WSPVQTAPYT YWAVHNWNAG GEAGGYAGFQ QQSGFDENGK RTLHFAIWDP ISSKEAIKAE       120
     YLSPNSQAGL FGGEGTGLKV QTTYGWKDYN WYRMTMRSWQ EDGHTKFGQW MKDVTKNKWH       180
     LIAIMDFPVA NVAFNHGLGM FQEDWADSGQ NVREARLKNG YSRKLVDKQW SSWNNQNISG       240
     THDNTYQYDG GATSEYVWVK AGGNTQSTIG SGKIFTLNQP TQPEIGKLDF DIQSIYYENE       300
     KLNVSWKLKE NSTPQFKGKI EIYNNENMTG QPINVIDDIK SYQNGISQSI SLPTNAYAKI       360
     VLTDLFDQTV EKKVQIKNQS PNIFEGNEFA WSLKGIGDFE FAKVNLNRSI EEIQIALKAG       420
     VPHNYFDSTY ASIKVQNTSG KVVYNKEIYG NKQQNAEQVK VPVKVGDFIE FTHLEGANRA       480
     TITNMEKNIQ ESFGNKAVYE ITKEGLKKVD NIVNPKPDTE APTQPQGLYA SNVTSNSIEL       540
     KWNPSTDNVG VKEYQVLRDG QLIQTVQGTT FTDQNLTVNK EYKYAVKAVD AAGNTSIQSD       600
     ILPVKTKNQN ESYEKWDPKK AYTKGDKVEH QGKIYEAVQN HQGNGDPNWI FALALWNPLT       660
//

If you have problems or comments...

PBIL Back to PBIL home page