(data stored in ACNUC9435 zone)

EMBL: CP000904.PE167

CP000904.PE167       Location/Qualifiers
FT   CDS             complement(250883..253132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5623"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: bcy:Bcer98_3446 S-layer
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5623"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46591"
FT                   /db_xref="GOA:A9VUM0"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR035423"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR042279"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM0"
FT                   /protein_id="ABY46591.1"
FT                   /translation="MKRVQKQKTKNLVMITATLSMFATGVTPSLEVFAEEQAQQKKVST
FT                   TLLQNENSVNVENRVFVVPGKGDVSQLQNIERRERNFSAYEPTGLYAKPNEQIIIQVQG
FT                   NQSIQAYIGTFSFDASWREDSKIKSFTLNPGTNTIQSPNGGMIYFYNKQQGGTIQTTVT
FT                   TGGAATPLFELGKHTKQDLINMLNQYPNAHAVELKGERVLITASPARVKKYLIGSNTDP
FT                   VQLLKKMDEATRIQDKISGLSEEQVDKHYLHYVEDNHSLDYYMYAYPHRTAYVGDAIQH
FT                   VLDINKFTNDGWGPWHEAGHMRQQAPWNFKNMTEVQVNLYSLAVEKAFTSNQPFRLQQE
FT                   GAYTKAFQYLEQSNKNYDEISDAFVKLVMLWQLQLAYGEDFYPKLHQLYRDMPLNEIPQ
FT                   TDETKKQLFMISSSKVAKQNLIPFFEKWGLRPNNDTIQKVAALGYPNLTAEIWKSTDSN
FT                   PVKPDTPNFSNILEGNQFAWSLKGIGDFEFAKVNLNKSTEEMQIALKAGVPHNYFDSTY
FT                   ASIKVQNTSGKVVYNKEIYGNKQQNAEQVKVPVKVGDFIEFTHLEGANRATITNMEKNI
FT                   QETFGNKAVYEITKEGLKKVDKIVNPKPDTEAPTQPQGLYASNVTSNSVELKWNPSTDN
FT                   VGVKEYQVLRDGQLIQTVKGTTFTDQNLTVNKEYKYTVKAVDAAGNTSIQSNILPVKTK
FT                   DQNVSYEKWDPKKAYTKGDKVEHQGRVYEAVQNHQGNGDQNWIFALSLWKPITIK"
     MKRVQKQKTK NLVMITATLS MFATGVTPSL EVFAEEQAQQ KKVSTTLLQN ENSVNVENRV        60
     FVVPGKGDVS QLQNIERRER NFSAYEPTGL YAKPNEQIII QVQGNQSIQA YIGTFSFDAS       120
     WREDSKIKSF TLNPGTNTIQ SPNGGMIYFY NKQQGGTIQT TVTTGGAATP LFELGKHTKQ       180
     DLINMLNQYP NAHAVELKGE RVLITASPAR VKKYLIGSNT DPVQLLKKMD EATRIQDKIS       240
     GLSEEQVDKH YLHYVEDNHS LDYYMYAYPH RTAYVGDAIQ HVLDINKFTN DGWGPWHEAG       300
     HMRQQAPWNF KNMTEVQVNL YSLAVEKAFT SNQPFRLQQE GAYTKAFQYL EQSNKNYDEI       360
     SDAFVKLVML WQLQLAYGED FYPKLHQLYR DMPLNEIPQT DETKKQLFMI SSSKVAKQNL       420
     IPFFEKWGLR PNNDTIQKVA ALGYPNLTAE IWKSTDSNPV KPDTPNFSNI LEGNQFAWSL       480
     KGIGDFEFAK VNLNKSTEEM QIALKAGVPH NYFDSTYASI KVQNTSGKVV YNKEIYGNKQ       540
     QNAEQVKVPV KVGDFIEFTH LEGANRATIT NMEKNIQETF GNKAVYEITK EGLKKVDKIV       600
     NPKPDTEAPT QPQGLYASNV TSNSVELKWN PSTDNVGVKE YQVLRDGQLI QTVKGTTFTD       660
     QNLTVNKEYK YTVKAVDAAG NTSIQSNILP VKTKDQNVSY EKWDPKKAYT KGDKVEHQGR       720
     VYEAVQNHQG NGDQNWIFAL SLWKPITIK                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page