(data stored in ACNUC9435 zone)

EMBL: CP000904.PE168

CP000904.PE168       Location/Qualifiers
FT   CDS             253576..254115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5624"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: pth:PTH_2445
FT                   site-specific recombinases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5624"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46592"
FT                   /db_xref="GOA:A9VUM1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM1"
FT                   /protein_id="ABY46592.1"
FT                   /translation="MANIYGYIRVSTKDQNEQRQLHKMMERGVEGRRIFVDKASRRHFD
FT                   RPQYQLLRKILSTGDIVVLENETLFDSRKFREMGDMGRLMEDQFLSLLSYVADQERKKI
FT                   HQRQAEGIAIAKSQGKHLGRPPVNLSTLSKQQIKIIEKTHSKWKSGEITAVMFMEMLEL
FT                   RKNTFYKIMKEYEEGK"
     MANIYGYIRV STKDQNEQRQ LHKMMERGVE GRRIFVDKAS RRHFDRPQYQ LLRKILSTGD        60
     IVVLENETLF DSRKFREMGD MGRLMEDQFL SLLSYVADQE RKKIHQRQAE GIAIAKSQGK       120
     HLGRPPVNLS TLSKQQIKII EKTHSKWKSG EITAVMFMEM LELRKNTFYK IMKEYEEGK        179
//

If you have problems or comments...

PBIL Back to PBIL home page