(data stored in ACNUC9435 zone)

EMBL: CP000904.PE169

CP000904.PE169       Location/Qualifiers
FT   CDS             complement(254700..254888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5625"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: bcz:pE33L466_0115 host
FT                   factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5625"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46593"
FT                   /db_xref="GOA:A9VUM2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM2"
FT                   /protein_id="ABY46593.1"
FT                   /translation="MYNLQEDMYEQLKEKKGDITIFLKNGVPIRGQILTTDKFTVLMMV
FT                   HGKQQLVYKQAISTILK"
     MYNLQEDMYE QLKEKKGDIT IFLKNGVPIR GQILTTDKFT VLMMVHGKQQ LVYKQAISTI        60
     LK                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page