(data stored in ACNUC9435 zone)

EMBL: CP000904.PE17

CP000904.PE17        Location/Qualifiers
FT   CDS             34810..36591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46441"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV09"
FT                   /protein_id="ABY46441.1"
FT                   /translation="MNAPVIESKILEKQREYLLEQAKLRLSISATQEEVSQLADEIFYR
FT                   YQSCIGKPLFQARKVVFGELPFLEDYYDNNKEMEKDLGILFSELNTIATYLVDYFNYSQ
FT                   SEKDRILSIVRSINGVVSDLQMLTEETTPNTVYLKESFMNYDNVDSVLTPVENRSMIHT
FT                   QEGVLTLRRTNALNRSIGSKVRTIQGNGIAGTYYLSRKVQSDSEFENYQYVSSQIKNDD
FT                   PKALIDGNADTVFEFEMVNIPESYKKQSFYYDVEWAKGKEHGDLLRVKIVVQLPKSETI
FT                   NWINLNPYHAAGSPGTANVYSIRTSNDGIEYQGLFEKDQFVLNQEINKTPQSYRAEDLF
FT                   DGSENFAKTKFSGQGVWSFPSREAKYIEFVLEQPNSYKELLGQEAFYRRKKDSTSFTRI
FT                   RKQEVPSNIVDEKYGIHTINSDYEIKKVLEAVEGWRYVIGVRDIDIMSFEFAEMSEYIS
FT                   KPFLLEDGIKKVLLYANEKVPAIYKEKVSESNDWIQYFVSFDDIDWHRISPQHQQPVND
FT                   KFPAKVLSVNDNESDIENAFALYKQNLQLKELPKQVRLKIIMKRPEKTTEDEIPLLHTT
FT                   PLVEDFALKILTEQKGV"
     MNAPVIESKI LEKQREYLLE QAKLRLSISA TQEEVSQLAD EIFYRYQSCI GKPLFQARKV        60
     VFGELPFLED YYDNNKEMEK DLGILFSELN TIATYLVDYF NYSQSEKDRI LSIVRSINGV       120
     VSDLQMLTEE TTPNTVYLKE SFMNYDNVDS VLTPVENRSM IHTQEGVLTL RRTNALNRSI       180
     GSKVRTIQGN GIAGTYYLSR KVQSDSEFEN YQYVSSQIKN DDPKALIDGN ADTVFEFEMV       240
     NIPESYKKQS FYYDVEWAKG KEHGDLLRVK IVVQLPKSET INWINLNPYH AAGSPGTANV       300
     YSIRTSNDGI EYQGLFEKDQ FVLNQEINKT PQSYRAEDLF DGSENFAKTK FSGQGVWSFP       360
     SREAKYIEFV LEQPNSYKEL LGQEAFYRRK KDSTSFTRIR KQEVPSNIVD EKYGIHTINS       420
     DYEIKKVLEA VEGWRYVIGV RDIDIMSFEF AEMSEYISKP FLLEDGIKKV LLYANEKVPA       480
     IYKEKVSESN DWIQYFVSFD DIDWHRISPQ HQQPVNDKFP AKVLSVNDNE SDIENAFALY       540
     KQNLQLKELP KQVRLKIIMK RPEKTTEDEI PLLHTTPLVE DFALKILTEQ KGV              593
//

If you have problems or comments...

PBIL Back to PBIL home page