(data stored in ACNUC9435 zone)

EMBL: CP000904.PE171

CP000904.PE171       Location/Qualifiers
FT   CDS             complement(256480..257343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5627"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46595"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM4"
FT                   /protein_id="ABY46595.1"
FT                   /translation="MNHLAFSPRELGGKSSPFLLTIEEWRSFAHYLNRWISAPTSIDQV
FT                   RERMYLILDGKVKNNWDRLITTSIFRELVEEAIATKLNVREKCRFWDNGGHKDILILSQ
FT                   NIVAFADLISIKYYNDLNQVIFEAQNGKLTPNTKSKFINICKDLSNHAQTYYQQSQSMA
FT                   TSLSEFYSEIQKYEETVQTWSHRMSYLSLHDSNDFVVAQNTVVYLVAPVMNLVQSKEFV
FT                   FPVIRKVHRIWSAISYDLKELADNIDDIENLEEFIAALELELAFEDWKAIRDEAENFYK
FT                   NAINIS"
     MNHLAFSPRE LGGKSSPFLL TIEEWRSFAH YLNRWISAPT SIDQVRERMY LILDGKVKNN        60
     WDRLITTSIF RELVEEAIAT KLNVREKCRF WDNGGHKDIL ILSQNIVAFA DLISIKYYND       120
     LNQVIFEAQN GKLTPNTKSK FINICKDLSN HAQTYYQQSQ SMATSLSEFY SEIQKYEETV       180
     QTWSHRMSYL SLHDSNDFVV AQNTVVYLVA PVMNLVQSKE FVFPVIRKVH RIWSAISYDL       240
     KELADNIDDI ENLEEFIAAL ELELAFEDWK AIRDEAENFY KNAINIS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page