(data stored in ACNUC9435 zone)

EMBL: CP000904.PE172

CP000904.PE172       Location/Qualifiers
FT   CDS             complement(257391..259715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5628"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5628"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46596"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM5"
FT                   /protein_id="ABY46596.1"
FT                   /translation="MLAHKVDYKKLYEELLNNQHIPGTFYSSTTKTKYEIRSLFVDLGE
FT                   VYKFIEENQLAPNMISIFADVVRIPDKFNCTLKDMQLVIRTRRVEIESDGKAEIRLDYK
FT                   DGSKLAQLTIYGLELSGTLHAIPIYNQSSPSPYPIELRNKGVRLSDKDGTFTKEEITYV
FT                   VPTPQFPKLFMSVFQVACLFYESQPDIAADQLNWLKAFTAQYKDLSSLCIQSTALLTIL
FT                   TANHGENTFVPLLDKDLYRDEIAAFLAAAQQFEEQYHRYLDRNLAIADRKAAATLMLQH
FT                   EQDTLLFKETLINQAKDNLRSAQNAVESSLYQFEKQQHVVTIAKIDFEYGLKKYHYEQQ
FT                   MKMAFKMLTAVLNFAESIGSIIATGGTAAPGEIIDIINSLKEVIEAGGQLAALAQSLKE
FT                   CMEKLNELVELINKIYALAAEISKASTDMDFSEELLKKIQENEWELPKEDLTGEATWKI
FT                   FQLKIAAALEDAIKKEVEGAREYLLSLDILAVYGQTLASNQVIIIRCSQELFRLLLEKH
FT                   IHQADLARLKEYIKNLEGQESENEEMEQKLYQRYLDMKQILFVALANYKHAYKYWALRD
FT                   SDVNPNILKDVSELKVDVATLQKDCMEALKQFNPPPQPFQNRTIEITDSNALKTLKETR
FT                   EASWEINLNDSFFENEYRVRLKLMRIWLDGVDATSKVQIRITNSGHYYDDYKNKKFQFN
FT                   TEPFNRGFSYVGATIITDGTIAEEFAYDYFIPNPFTTWTIKVQDGPDLSKVTKIRMELA
FT                   GSLVANYKKHNPVLNGLMESF"
     MLAHKVDYKK LYEELLNNQH IPGTFYSSTT KTKYEIRSLF VDLGEVYKFI EENQLAPNMI        60
     SIFADVVRIP DKFNCTLKDM QLVIRTRRVE IESDGKAEIR LDYKDGSKLA QLTIYGLELS       120
     GTLHAIPIYN QSSPSPYPIE LRNKGVRLSD KDGTFTKEEI TYVVPTPQFP KLFMSVFQVA       180
     CLFYESQPDI AADQLNWLKA FTAQYKDLSS LCIQSTALLT ILTANHGENT FVPLLDKDLY       240
     RDEIAAFLAA AQQFEEQYHR YLDRNLAIAD RKAAATLMLQ HEQDTLLFKE TLINQAKDNL       300
     RSAQNAVESS LYQFEKQQHV VTIAKIDFEY GLKKYHYEQQ MKMAFKMLTA VLNFAESIGS       360
     IIATGGTAAP GEIIDIINSL KEVIEAGGQL AALAQSLKEC MEKLNELVEL INKIYALAAE       420
     ISKASTDMDF SEELLKKIQE NEWELPKEDL TGEATWKIFQ LKIAAALEDA IKKEVEGARE       480
     YLLSLDILAV YGQTLASNQV IIIRCSQELF RLLLEKHIHQ ADLARLKEYI KNLEGQESEN       540
     EEMEQKLYQR YLDMKQILFV ALANYKHAYK YWALRDSDVN PNILKDVSEL KVDVATLQKD       600
     CMEALKQFNP PPQPFQNRTI EITDSNALKT LKETREASWE INLNDSFFEN EYRVRLKLMR       660
     IWLDGVDATS KVQIRITNSG HYYDDYKNKK FQFNTEPFNR GFSYVGATII TDGTIAEEFA       720
     YDYFIPNPFT TWTIKVQDGP DLSKVTKIRM ELAGSLVANY KKHNPVLNGL MESF             774
//

If you have problems or comments...

PBIL Back to PBIL home page