(data stored in ACNUC9435 zone)

EMBL: CP000904.PE173

CP000904.PE173       Location/Qualifiers
FT   CDS             complement(259943..261004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5629"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46597"
FT                   /db_xref="GOA:A9VUM6"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM6"
FT                   /protein_id="ABY46597.1"
FT                   /translation="MVKRDISARDLGGKEDNPFLLKKDEWIRIQKYTGDGAYLPVNVNE
FT                   MRKALALENTAELPDFGELYTVNTSIKGHCKNWNDTTYREILDVANQIVNYSRRAEVFY
FT                   APLLDYLPDILEGDTVALEKFQKICEKLAKEAKAFSDHAETLAKTVKQFADDTTNDYKN
FT                   LINVKVKYDALYGKNSEEEIKLRAEVKKLREELEKYIEDYEDYESESWLSLLLGPVFGF
FT                   ILKGILDSTHGQMLKAKVDATRQKIEATCATIQRNVYLMSLLDKADVGTDKTQKQIEEA
FT                   LPVINKIKAIWSALHKDLLTLSTITMKDIHDDPEFADLGIELAIMQWVKVGKQADDFRI
FT                   NADVGYILDQYIA"
     MVKRDISARD LGGKEDNPFL LKKDEWIRIQ KYTGDGAYLP VNVNEMRKAL ALENTAELPD        60
     FGELYTVNTS IKGHCKNWND TTYREILDVA NQIVNYSRRA EVFYAPLLDY LPDILEGDTV       120
     ALEKFQKICE KLAKEAKAFS DHAETLAKTV KQFADDTTND YKNLINVKVK YDALYGKNSE       180
     EEIKLRAEVK KLREELEKYI EDYEDYESES WLSLLLGPVF GFILKGILDS THGQMLKAKV       240
     DATRQKIEAT CATIQRNVYL MSLLDKADVG TDKTQKQIEE ALPVINKIKA IWSALHKDLL       300
     TLSTITMKDI HDDPEFADLG IELAIMQWVK VGKQADDFRI NADVGYILDQ YIA              353
//

If you have problems or comments...

PBIL Back to PBIL home page