(data stored in ACNUC9435 zone)

EMBL: CP000904.PE174

CP000904.PE174       Location/Qualifiers
FT   CDS             complement(262208..263032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5631"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46598"
FT                   /db_xref="GOA:A9VUM7"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM7"
FT                   /protein_id="ABY46598.1"
FT                   /translation="MNDTMCPETSTCSSCSPEPYSWEWVAVEATGGVISGVAGFAAVAL
FT                   IKHLFIKEEADQTRDLFKEAVEQICNYINKAIDEAFIREYLADTDNVKEQLKYFAGSNG
FT                   NNIKLIEDIQSEASRLVQRFYRLGDIAIGALELACSLHLVILKTLATHNPDNWKVPFET
FT                   STKEYAEMLSHNANEFLNNVKSRITPPEFGMLPDGGIPPTKLTLGCQFNVDDEPLSFGY
FT                   GTVTISDDQAIERAREQCNQRHKEKYDEIVNPGILVYNKIMAVSTDLKNIQF"
     MNDTMCPETS TCSSCSPEPY SWEWVAVEAT GGVISGVAGF AAVALIKHLF IKEEADQTRD        60
     LFKEAVEQIC NYINKAIDEA FIREYLADTD NVKEQLKYFA GSNGNNIKLI EDIQSEASRL       120
     VQRFYRLGDI AIGALELACS LHLVILKTLA THNPDNWKVP FETSTKEYAE MLSHNANEFL       180
     NNVKSRITPP EFGMLPDGGI PPTKLTLGCQ FNVDDEPLSF GYGTVTISDD QAIERAREQC       240
     NQRHKEKYDE IVNPGILVYN KIMAVSTDLK NIQF                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page