(data stored in ACNUC9435 zone)

EMBL: CP000904.PE175

CP000904.PE175       Location/Qualifiers
FT   CDS             complement(263503..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5632"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   baa:BXA0056 IS231-related, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5632"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46599"
FT                   /db_xref="GOA:A9VUM8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM8"
FT                   /protein_id="ABY46599.1"
FT                   /translation="MTLSIQDEFHLFAEELQRYLSPNILQQLAQETGFVKRKSKYGARD
FT                   LDALCIWISQHVASDSLTRLCSQLYANTATLMSPEGLNQRFNRCAVLFLQRIFSLLVKS
FT                   QLNDSSQIKNQYTSYFQRIRILDATIFQVPNHLAPIYPGSGGCAQTAGIKIQLEYDLHS
FT                   GKFLNFQMEPGKNNDKTFVTDCLDTLSPGDLCIRDLGYFSLKDLDQMDQRGVFYVSRLK
FT                   LNNRVYVKNDSPEFFRDGTVKKQSLYVLLNLEDIMHQIKPGDTYEIRNAYIGQQKLPSR
FT                   VVIYRLTSTQTHKRRKQQTYVEKKKGVTYSEKSKRLTEINVYITNIPWEIVPMEQVHNI
FT                   YSLRWQIEIVFKTWKSLFGINHCHNIKRERLECHLYGQLIAIFLCSSTMFKMRQLLLQK
FT                   KQKELSEYKAIYIIQDHLYLVYEAIQKDTQEVSKIFLCLFDFLQKNGRKSHRYEKKTVF
FT                   DILGVVYQFTVSNLKQKTA"
     MTLSIQDEFH LFAEELQRYL SPNILQQLAQ ETGFVKRKSK YGARDLDALC IWISQHVASD        60
     SLTRLCSQLY ANTATLMSPE GLNQRFNRCA VLFLQRIFSL LVKSQLNDSS QIKNQYTSYF       120
     QRIRILDATI FQVPNHLAPI YPGSGGCAQT AGIKIQLEYD LHSGKFLNFQ MEPGKNNDKT       180
     FVTDCLDTLS PGDLCIRDLG YFSLKDLDQM DQRGVFYVSR LKLNNRVYVK NDSPEFFRDG       240
     TVKKQSLYVL LNLEDIMHQI KPGDTYEIRN AYIGQQKLPS RVVIYRLTST QTHKRRKQQT       300
     YVEKKKGVTY SEKSKRLTEI NVYITNIPWE IVPMEQVHNI YSLRWQIEIV FKTWKSLFGI       360
     NHCHNIKRER LECHLYGQLI AIFLCSSTMF KMRQLLLQKK QKELSEYKAI YIIQDHLYLV       420
     YEAIQKDTQE VSKIFLCLFD FLQKNGRKSH RYEKKTVFDI LGVVYQFTVS NLKQKTA          477
//

If you have problems or comments...

PBIL Back to PBIL home page