(data stored in ACNUC9435 zone)

EMBL: CP000904.PE176

CP000904.PE176       Location/Qualifiers
FT   CDS             complement(265011..265394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46600"
FT                   /db_xref="GOA:A9VUM9"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM9"
FT                   /protein_id="ABY46600.1"
FT                   /translation="MIQMKKKATLFFFLNIVIIGMLIFNLFVFTTRMPFLPWFIEDGWG
FT                   YLGLVLTSFVLLIISLKSYQLYKNGEITILQISIPLVSAMFSLFVMFMPLNDFMTIFSL
FT                   IVDVSILIISLISFRGTVTSLSN"
     MIQMKKKATL FFFLNIVIIG MLIFNLFVFT TRMPFLPWFI EDGWGYLGLV LTSFVLLIIS        60
     LKSYQLYKNG EITILQISIP LVSAMFSLFV MFMPLNDFMT IFSLIVDVSI LIISLISFRG       120
     TVTSLSN                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page