(data stored in ACNUC9435 zone)

EMBL: CP000904.PE177

CP000904.PE177       Location/Qualifiers
FT   CDS             complement(265485..265943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5634"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: dsy:DSY0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5634"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46601"
FT                   /db_xref="GOA:A9VUN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN0"
FT                   /protein_id="ABY46601.1"
FT                   /translation="MDKQEFIQLVNKKLKLIRIENDLSQDKMSEVIGLSKKTLVEIEKG
FT                   RRSLTWTGAVCVVTLFEDSDIIQMTFGDDINEIIKTIAFTHYNNSSSKTLGGKLWWRQI
FT                   RELNGYKIQQNILSQHYRILNKENHRICSSFELDEIEKRFIEVTKSLQ"
     MDKQEFIQLV NKKLKLIRIE NDLSQDKMSE VIGLSKKTLV EIEKGRRSLT WTGAVCVVTL        60
     FEDSDIIQMT FGDDINEIIK TIAFTHYNNS SSKTLGGKLW WRQIRELNGY KIQQNILSQH       120
     YRILNKENHR ICSSFELDEI EKRFIEVTKS LQ                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page