(data stored in ACNUC9435 zone)

EMBL: CP000904.PE178

CP000904.PE178       Location/Qualifiers
FT   CDS             complement(266142..266510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5635"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46602"
FT                   /db_xref="GOA:A9VUN1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN1"
FT                   /protein_id="ABY46602.1"
FT                   /translation="MIQMKKKSNHYLFINNVIIGMLILNLFIFTSSIRFLPWFIEDGWG
FT                   TLGLLLTSFVLLITFFKSYQLHKNGERTILQTSIPLVSAMFSFFVMLTLSDFMTIFSLI
FT                   VNVSILIICLISFGKNSN"
     MIQMKKKSNH YLFINNVIIG MLILNLFIFT SSIRFLPWFI EDGWGTLGLL LTSFVLLITF        60
     FKSYQLHKNG ERTILQTSIP LVSAMFSFFV MLTLSDFMTI FSLIVNVSIL IICLISFGKN       120
     SN                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page