(data stored in ACNUC9435 zone)

EMBL: CP000904.PE179

CP000904.PE179       Location/Qualifiers
FT   CDS             complement(267692..270076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5637"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: bcy:Bcer98_1722
FT                   penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5637"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46603"
FT                   /db_xref="GOA:A9VUN2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN2"
FT                   /protein_id="ABY46603.1"
FT                   /translation="MSENYLSRTERKQVHKNEKPNTKKNKKQTSFFRKLLIGCLVLGTL
FT                   GLIGVATTFFTLIKDAPILEKSKLVNPLSAKIYDKDGKLIYEYGKEKRTNITYNQLPKL
FT                   IENAFLATEDARFYDHSGVDFKGTARAVLVSLTGNYGSQGGSTITQQVIKNYFLSTEKT
FT                   AKRKVQEIYLAHKLEKRYSKHQILEMYLNKIYLGNRSYGIRTAAQNYYGKELKDLTLPQ
FT                   VAMLAGLPKGPSIYDPTKQQNIEKATERRNVVLSAMYQNKYISEEQMTEASRVSVKEGL
FT                   MPPKEVNEMPYPVFIDAVVKEVEKELPDAHIESDGLSIYTTLDPKAQKFAENILNTNII
FT                   SYPNDNFQGAFTFMDTKTGEVRAIGSGRGENKATFKGENMAIELKRSIGSTMKPIFDYG
FT                   PAIEYLKWPTSHQLDDSNYKYSTGQKVQNADRTYKGMMTMRDALKMSRNIPAIKTAKEV
FT                   GISKAQGFAEGLGIKFGKEVPESTAIGTNEGSPTEIAGAYAAFGNDGKYTKPHFVKKVV
FT                   YPDGESKSFEPKSKRVMEDYTAYIVTDMLRSVVTSGTGTAANVDSLDVAGKTGTTNYSA
FT                   ADVAKYGIPSSASRDSWFAGYTPQYTMAVWTGYMKNGPEDYISSKNTKIAQQIFKEMMH
FT                   KFGTNKSKFKMPKTVIQDNSELRVKGAKQESSPNVNTNTVIQMETGEKDQKQEQNEQDK
FT                   NQQEQKQGEQDKNQQEQKQSEQDKNQQEQKQSGQDKNQQEQKQSGQDKNQQEQKQGEQD
FT                   KNQQEQKQSEQDKNQQEQKQGEQDKNQQEQKQGEQDKNQQD"
     MSENYLSRTE RKQVHKNEKP NTKKNKKQTS FFRKLLIGCL VLGTLGLIGV ATTFFTLIKD        60
     APILEKSKLV NPLSAKIYDK DGKLIYEYGK EKRTNITYNQ LPKLIENAFL ATEDARFYDH       120
     SGVDFKGTAR AVLVSLTGNY GSQGGSTITQ QVIKNYFLST EKTAKRKVQE IYLAHKLEKR       180
     YSKHQILEMY LNKIYLGNRS YGIRTAAQNY YGKELKDLTL PQVAMLAGLP KGPSIYDPTK       240
     QQNIEKATER RNVVLSAMYQ NKYISEEQMT EASRVSVKEG LMPPKEVNEM PYPVFIDAVV       300
     KEVEKELPDA HIESDGLSIY TTLDPKAQKF AENILNTNII SYPNDNFQGA FTFMDTKTGE       360
     VRAIGSGRGE NKATFKGENM AIELKRSIGS TMKPIFDYGP AIEYLKWPTS HQLDDSNYKY       420
     STGQKVQNAD RTYKGMMTMR DALKMSRNIP AIKTAKEVGI SKAQGFAEGL GIKFGKEVPE       480
     STAIGTNEGS PTEIAGAYAA FGNDGKYTKP HFVKKVVYPD GESKSFEPKS KRVMEDYTAY       540
     IVTDMLRSVV TSGTGTAANV DSLDVAGKTG TTNYSAADVA KYGIPSSASR DSWFAGYTPQ       600
     YTMAVWTGYM KNGPEDYISS KNTKIAQQIF KEMMHKFGTN KSKFKMPKTV IQDNSELRVK       660
     GAKQESSPNV NTNTVIQMET GEKDQKQEQN EQDKNQQEQK QGEQDKNQQE QKQSEQDKNQ       720
     QEQKQSGQDK NQQEQKQSGQ DKNQQEQKQG EQDKNQQEQK QSEQDKNQQE QKQGEQDKNQ       780
     QEQKQGEQDK NQQD                                                         794
//

If you have problems or comments...

PBIL Back to PBIL home page