(data stored in ACNUC9435 zone)

EMBL: CP000904.PE18

CP000904.PE18        Location/Qualifiers
FT   CDS             36595..38649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46442"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV10"
FT                   /protein_id="ABY46442.1"
FT                   /translation="MSINIRQKRFTVAVNQILQEELRKGNLPTSKEFASRLNKLLRDQE
FT                   LGAPEYKFKLIRNGELAESDFFNEVVGKIQKDLMILYENTIAVHNQLKGKFHWFEVEKN
FT                   RLEYEARRLESELKEKILLYGKTGYLASIFDTFDDLSKIDSEDNVSIDIKNHQITLKKQ
FT                   ENTSFLINPASEIKFVMPKSSVSTFKKIPISGKIEQALNANTNETFQEVWLSKTEGPAD
FT                   GYIDIKFNDKQVLNRIDLSLHTIKSATVYIEFSLDELNYFHLPYYPDGKQTGNNVSFYF
FT                   PTTEMKNMRIWIRKQESDKEIVHPEGYSYQYLFGVKKIQFFQLSYPERGEVVTKFLTPK
FT                   TDETFSIGKVSLVTEEEIPDGTDIEYFVRVDDREESWKQISPVNRDTAQAPNLIDFKYV
FT                   VHASPTNLGIRKNIGGQESEIIELQANGVAFYSLGSIEKRKIVPRTERLYMGKDAWSVQ
FT                   KTVENFGETHIPSLDDWKKPSNDIVRNVIPIQEGHRGLILQDEQFTQHTQLYYGMGIFY
FT                   EGKEQVLSTIPSSTEPIAIFLNGEKLFEGIPSSQTNVNYKFKQGWNDLTVLVYVQNLNK
FT                   DCTIDLGFDPIRVSTHCYSSSQFLEKVSVFDLRYNTKNNDWSKYALYEKDGKVYIVVNH
FT                   SLPGVTYDFYYDYVDEVEHRNIQLKIAMKQFSVGQYTTPVLRRYTLQFS"
     MSINIRQKRF TVAVNQILQE ELRKGNLPTS KEFASRLNKL LRDQELGAPE YKFKLIRNGE        60
     LAESDFFNEV VGKIQKDLMI LYENTIAVHN QLKGKFHWFE VEKNRLEYEA RRLESELKEK       120
     ILLYGKTGYL ASIFDTFDDL SKIDSEDNVS IDIKNHQITL KKQENTSFLI NPASEIKFVM       180
     PKSSVSTFKK IPISGKIEQA LNANTNETFQ EVWLSKTEGP ADGYIDIKFN DKQVLNRIDL       240
     SLHTIKSATV YIEFSLDELN YFHLPYYPDG KQTGNNVSFY FPTTEMKNMR IWIRKQESDK       300
     EIVHPEGYSY QYLFGVKKIQ FFQLSYPERG EVVTKFLTPK TDETFSIGKV SLVTEEEIPD       360
     GTDIEYFVRV DDREESWKQI SPVNRDTAQA PNLIDFKYVV HASPTNLGIR KNIGGQESEI       420
     IELQANGVAF YSLGSIEKRK IVPRTERLYM GKDAWSVQKT VENFGETHIP SLDDWKKPSN       480
     DIVRNVIPIQ EGHRGLILQD EQFTQHTQLY YGMGIFYEGK EQVLSTIPSS TEPIAIFLNG       540
     EKLFEGIPSS QTNVNYKFKQ GWNDLTVLVY VQNLNKDCTI DLGFDPIRVS THCYSSSQFL       600
     EKVSVFDLRY NTKNNDWSKY ALYEKDGKVY IVVNHSLPGV TYDFYYDYVD EVEHRNIQLK       660
     IAMKQFSVGQ YTTPVLRRYT LQFS                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page