(data stored in ACNUC9435 zone)

EMBL: CP000904.PE180

CP000904.PE180       Location/Qualifiers
FT   CDS             complement(271598..272314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5638"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: lla:L154512 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5638"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46604"
FT                   /db_xref="GOA:A9VUN3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN3"
FT                   /protein_id="ABY46604.1"
FT                   /translation="MKWRIPMKKQQPQISEDKILEASWELLGEEGIEKLSMRRLADRLG
FT                   IQAPSLYWYFKSKQNLYQRLANQVSKIILEEFHSEGDWKEQLSELAVTVRSVLSRYPCS
FT                   TQIMMMTLPHEPDIIRFTNRMLLCVESTPLEQEQKMQVVTTLVNYVYYFVLDDYQHQRN
FT                   VSAILKVNETLPGEEMIPGEEMIRLLDSMNETDAGLFRRMFTNGLFELMGTDRAFEFGL
FT                   NLILLGVEQVIKEQVE"
     MKWRIPMKKQ QPQISEDKIL EASWELLGEE GIEKLSMRRL ADRLGIQAPS LYWYFKSKQN        60
     LYQRLANQVS KIILEEFHSE GDWKEQLSEL AVTVRSVLSR YPCSTQIMMM TLPHEPDIIR       120
     FTNRMLLCVE STPLEQEQKM QVVTTLVNYV YYFVLDDYQH QRNVSAILKV NETLPGEEMI       180
     PGEEMIRLLD SMNETDAGLF RRMFTNGLFE LMGTDRAFEF GLNLILLGVE QVIKEQVE         238
//

If you have problems or comments...

PBIL Back to PBIL home page