(data stored in ACNUC9435 zone)

EMBL: CP000904.PE181

CP000904.PE181       Location/Qualifiers
FT   CDS             272427..273779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5639"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ssp:SSP2140
FT                   putative Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5639"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46605"
FT                   /db_xref="GOA:A9VUN4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN4"
FT                   /protein_id="ABY46605.1"
FT                   /translation="MDAENLYYFEKASVSKAVAHFAVPMMLGTSMSVIYSILNAYFLGT
FT                   LHSTAMLTALALTLPLFAIIMALGNLIGMGSGTFISRLLGEKKYDDVKHVSSFAFYSSL
FT                   VLGLIAIAVGLPLIDQIVYGLGATSDSFEFTKDYVTIMIIGSPFVILFFTLENIVRSEG
FT                   AAITSMIGMILSVVVNIILDSLVIFVFHWGVTGVASATVISSVVASAFYAFHIRYKSQF
FT                   LTVSAKWFKVTKEILSNVFKIGVPVFIMSIFLGAMSLILNHFLIEYGDQAVAAYGISSR
FT                   LLQFPEFILMGLCEGIVPLIAFSFTANKMRMKHTIGFTIKTIVALAFVFGVIVYLISDN
FT                   LIGLFTNDPHLIEMGSYILHVTFLSLFITGMTALFTGIFQATAQGTAAFIMSIIQGITL
FT                   IPVLFIANHMYGFHGVIWSLVIADAVSFLVGAIMLYVLRNKLQPDLDSLVQ"
     MDAENLYYFE KASVSKAVAH FAVPMMLGTS MSVIYSILNA YFLGTLHSTA MLTALALTLP        60
     LFAIIMALGN LIGMGSGTFI SRLLGEKKYD DVKHVSSFAF YSSLVLGLIA IAVGLPLIDQ       120
     IVYGLGATSD SFEFTKDYVT IMIIGSPFVI LFFTLENIVR SEGAAITSMI GMILSVVVNI       180
     ILDSLVIFVF HWGVTGVASA TVISSVVASA FYAFHIRYKS QFLTVSAKWF KVTKEILSNV       240
     FKIGVPVFIM SIFLGAMSLI LNHFLIEYGD QAVAAYGISS RLLQFPEFIL MGLCEGIVPL       300
     IAFSFTANKM RMKHTIGFTI KTIVALAFVF GVIVYLISDN LIGLFTNDPH LIEMGSYILH       360
     VTFLSLFITG MTALFTGIFQ ATAQGTAAFI MSIIQGITLI PVLFIANHMY GFHGVIWSLV       420
     IADAVSFLVG AIMLYVLRNK LQPDLDSLVQ                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page