(data stored in ACNUC9435 zone)

EMBL: CP000904.PE183

CP000904.PE183       Location/Qualifiers
FT   CDS             274649..274987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5641"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46607"
FT                   /db_xref="GOA:A9VUN6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN6"
FT                   /protein_id="ABY46607.1"
FT                   /translation="MGLLAFEWYEKQQISITSLFVATIILQSLFMKRILKGKKESENFI
FT                   DEMFLHIRQKSLSICCFVMYVLTLGTLFLSEGTWNFSHMHNKPLIFLVFLYPIVYQISH
FT                   IFVSRNNS"
     MGLLAFEWYE KQQISITSLF VATIILQSLF MKRILKGKKE SENFIDEMFL HIRQKSLSIC        60
     CFVMYVLTLG TLFLSEGTWN FSHMHNKPLI FLVFLYPIVY QISHIFVSRN NS               112
//

If you have problems or comments...

PBIL Back to PBIL home page