(data stored in ACNUC9435 zone)

EMBL: CP000904.PE184

CP000904.PE184       Location/Qualifiers
FT   CDS             275505..276251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5642"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46608"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN7"
FT                   /protein_id="ABY46608.1"
FT                   /translation="MHYYPPFLLVFWFSKPFIHCLSAYNPFLTLPFRMQKVTWLQDLGV
FT                   CQQIKARRHGKIAPSVYILTLHTNYLKIVEYFKIKWTVAIDICSTFISFLTNKHSKKNI
FT                   QTSSSVDLFSLEEQLKPNTDIQSKEDKNRLQDLNDYLSDDQKKAYYYILSQELTYLSEN
FT                   DAYIIALRLPPDIDRYTRWDIEECVQWFQFNTAEISNPAHFIKMFNQKSKQNQERRKRH
FT                   TKKTNSFLGANNNRKFIFFNFLEENS"
     MHYYPPFLLV FWFSKPFIHC LSAYNPFLTL PFRMQKVTWL QDLGVCQQIK ARRHGKIAPS        60
     VYILTLHTNY LKIVEYFKIK WTVAIDICST FISFLTNKHS KKNIQTSSSV DLFSLEEQLK       120
     PNTDIQSKED KNRLQDLNDY LSDDQKKAYY YILSQELTYL SENDAYIIAL RLPPDIDRYT       180
     RWDIEECVQW FQFNTAEISN PAHFIKMFNQ KSKQNQERRK RHTKKTNSFL GANNNRKFIF       240
     FNFLEENS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page