(data stored in ACNUC9435 zone)

EMBL: CP000904.PE185

CP000904.PE185       Location/Qualifiers
FT   CDS             complement(277903..279594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5644"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46609"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN8"
FT                   /protein_id="ABY46609.1"
FT                   /translation="MAKPFVIKNKRSLNGETTTPVLVTIKAWQKLVEALEGKYYSFKDT
FT                   YLEDIVNSMSYEERIADEEGFVEKAKPSFSLQMKNLFTKANGRKHKLYGITNADLEVFL
FT                   FLHKKCNTYGELSHVSIHMLWEDYKNYKEVFAHIHHSQFYVALKKLSLHNIIEIENEYS
FT                   GKYKITLTDFMNKETNKANPYTFISPIVFTKEFFDLSIAAKKLFIDIAMQQKRETTLKR
FT                   SLYKFDEQGQQTHFGGIYRFLHKKYPHQIRSVMAELTTKSTATGSSLFKICKLEKGKKN
FT                   KKQYTTLHLSVHPDFLCNKEIGEEYRDPFTPRLTYKRKAKFIEESLVEMNIAEFTKDIN
FT                   QFVNVLKHSCHRQIRQVIRGLREMIDRQEGFPKNLVYTLSKLLKQSSQYRVLDTAAKTG
FT                   IYSLITHNVPREKQEDAVFKFGTHFAIYSLQNVKKLFCKAHDLLHATYAVPVTEEAYHR
FT                   NYMQYQEETLFRKYAFEQGVNVNAYIALEIKIRELLKSHGHKEHHIPSDIRELFIEKID
FT                   RLPKEKIRVIEVPKDFNLIDFLHSLEAYYRKNSETPCTVDQLLPAM"
     MAKPFVIKNK RSLNGETTTP VLVTIKAWQK LVEALEGKYY SFKDTYLEDI VNSMSYEERI        60
     ADEEGFVEKA KPSFSLQMKN LFTKANGRKH KLYGITNADL EVFLFLHKKC NTYGELSHVS       120
     IHMLWEDYKN YKEVFAHIHH SQFYVALKKL SLHNIIEIEN EYSGKYKITL TDFMNKETNK       180
     ANPYTFISPI VFTKEFFDLS IAAKKLFIDI AMQQKRETTL KRSLYKFDEQ GQQTHFGGIY       240
     RFLHKKYPHQ IRSVMAELTT KSTATGSSLF KICKLEKGKK NKKQYTTLHL SVHPDFLCNK       300
     EIGEEYRDPF TPRLTYKRKA KFIEESLVEM NIAEFTKDIN QFVNVLKHSC HRQIRQVIRG       360
     LREMIDRQEG FPKNLVYTLS KLLKQSSQYR VLDTAAKTGI YSLITHNVPR EKQEDAVFKF       420
     GTHFAIYSLQ NVKKLFCKAH DLLHATYAVP VTEEAYHRNY MQYQEETLFR KYAFEQGVNV       480
     NAYIALEIKI RELLKSHGHK EHHIPSDIRE LFIEKIDRLP KEKIRVIEVP KDFNLIDFLH       540
     SLEAYYRKNS ETPCTVDQLL PAM                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page