(data stored in ACNUC9435 zone)

EMBL: CP000904.PE187

CP000904.PE187       Location/Qualifiers
FT   CDS             283310..283993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5646"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; fatty acid
FT                   responsive transcription factor FadR domain protein; KEGG:
FT                   ilo:IL1821 negative regulator for fad regulon"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5646"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46611"
FT                   /db_xref="GOA:A9VUP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP0"
FT                   /protein_id="ABY46611.1"
FT                   /translation="MKEKERSSDKIENELIRSILAGVYSVGSTLPPERELAKEFGVGRP
FT                   TIREALQRLERSGWITGRKGMPAIINDYWSNGNLTTLINIVENHHTITDEFIMYLLEFR
FT                   SSLTPTYIRDAVTFNQPKVVALLANLEQLEDSAESYAAFDWYLQKRCAGLAANPIFLLI
FT                   LNSFDSIYVDMAKRYFSVKDHRGLSFNYYHDLLKAALKGDAIEAERLCKTTLEKSLALW
FT                   KDRKK"
     MKEKERSSDK IENELIRSIL AGVYSVGSTL PPERELAKEF GVGRPTIREA LQRLERSGWI        60
     TGRKGMPAII NDYWSNGNLT TLINIVENHH TITDEFIMYL LEFRSSLTPT YIRDAVTFNQ       120
     PKVVALLANL EQLEDSAESY AAFDWYLQKR CAGLAANPIF LLILNSFDSI YVDMAKRYFS       180
     VKDHRGLSFN YYHDLLKAAL KGDAIEAERL CKTTLEKSLA LWKDRKK                     227
//

If you have problems or comments...

PBIL Back to PBIL home page