(data stored in ACNUC9435 zone)

EMBL: CP000904.PE189

CP000904.PE189       Location/Qualifiers
FT   CDS             285907..286323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5648"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46613"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP2"
FT                   /protein_id="ABY46613.1"
FT                   /translation="MNEVLSEKYKVIKFPAEVVNMFADILEEDEILYNVFHYIGSEVNK
FT                   QYQETKYMRGISINEIVGNVVIDRRVKKLKGKSYSLEVERTNISRRSAEVSVSTLSSMS
FT                   LITEKIMHPYKFLISTIRGQQVLIELGKRKETNR"
     MNEVLSEKYK VIKFPAEVVN MFADILEEDE ILYNVFHYIG SEVNKQYQET KYMRGISINE        60
     IVGNVVIDRR VKKLKGKSYS LEVERTNISR RSAEVSVSTL SSMSLITEKI MHPYKFLIST       120
     IRGQQVLIEL GKRKETNR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page