(data stored in ACNUC9435 zone)

EMBL: CP000904.PE19

CP000904.PE19        Location/Qualifiers
FT   CDS             38828..39601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5451"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46443"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV11"
FT                   /protein_id="ABY46443.1"
FT                   /translation="MQIEKKYKPSFHKANARYRGVTELSQYTNFVLESAHDLLLLGNIT
FT                   EGNEATHKDGHKKEMYNNFISIMTGDREVGKSSLFTASTLQKIDYSRTVPIPELDSWSP
FT                   LNGCTKTAVSDAIKLSSNGLLDPVGMFSTLYVEPGDKLYIRMKVRSTGGASDFSFGSNN
FT                   MRMGPDKNGDTRKVPLAKSNEFITLDYVLRFQYAESVSININVHEKPNELKAENVEIKD
FT                   LEIYYFNETPIQASSIDMVIKPNVDELEEKINSIR"
     MQIEKKYKPS FHKANARYRG VTELSQYTNF VLESAHDLLL LGNITEGNEA THKDGHKKEM        60
     YNNFISIMTG DREVGKSSLF TASTLQKIDY SRTVPIPELD SWSPLNGCTK TAVSDAIKLS       120
     SNGLLDPVGM FSTLYVEPGD KLYIRMKVRS TGGASDFSFG SNNMRMGPDK NGDTRKVPLA       180
     KSNEFITLDY VLRFQYAESV SININVHEKP NELKAENVEI KDLEIYYFNE TPIQASSIDM       240
     VIKPNVDELE EKINSIR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page