(data stored in ACNUC9435 zone)

EMBL: CP000904.PE190

CP000904.PE190       Location/Qualifiers
FT   CDS             286344..287798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5649"
FT                   /product="putative FtsZ/tubulin-related protein"
FT                   /note="KEGG: bcz:pE33L466_0217 possible
FT                   FtsZ/tubulin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5649"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46614"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP3"
FT                   /protein_id="ABY46614.1"
FT                   /translation="MAKNFLKNEVAVKMTMVGFGQAGTRMVDKFAEYKHTDGTSVYNCL
FT                   ALNSNDGDLAELKNVPKSNQVSLKLGGLGKNPERAVKVLESNDEAKAKLKEFITERVRP
FT                   TDELVLFFAGLGGGTGTSTIIKAIEEFSAFHNKPIIAEELKSMAMKISREELIANQQKY
FT                   ARIAFNNAIERKDFIKMGIVVTLPVRADGPDVLRQVNKFSQEIWKLANEPAKGVAFVVF
FT                   ADNQHFYDEFKGLNENEKKGIANSRDYANQRIGEIIHELNTASNGAGTSVILDSQDFKR
FT                   ILLEKTGCLVINKISRNMNQIENSKEIVDMFSESLKGSSFHPPIELMKKNDDGELEASK
FT                   VHHFGMLAILDEQKNIDDSFMDDAKVEVTNTLPINGTVFNGYLISKNDFMGSVYTFYKT
FT                   DALPSRLSKGLVEEFNEFKEKQNQIQFKKSQISTIEMQDQDDDFSINFGDYIDMGTSNE
FT                   EPSADAENDEELAAFMDPDKMFGTSK"
     MAKNFLKNEV AVKMTMVGFG QAGTRMVDKF AEYKHTDGTS VYNCLALNSN DGDLAELKNV        60
     PKSNQVSLKL GGLGKNPERA VKVLESNDEA KAKLKEFITE RVRPTDELVL FFAGLGGGTG       120
     TSTIIKAIEE FSAFHNKPII AEELKSMAMK ISREELIANQ QKYARIAFNN AIERKDFIKM       180
     GIVVTLPVRA DGPDVLRQVN KFSQEIWKLA NEPAKGVAFV VFADNQHFYD EFKGLNENEK       240
     KGIANSRDYA NQRIGEIIHE LNTASNGAGT SVILDSQDFK RILLEKTGCL VINKISRNMN       300
     QIENSKEIVD MFSESLKGSS FHPPIELMKK NDDGELEASK VHHFGMLAIL DEQKNIDDSF       360
     MDDAKVEVTN TLPINGTVFN GYLISKNDFM GSVYTFYKTD ALPSRLSKGL VEEFNEFKEK       420
     QNQIQFKKSQ ISTIEMQDQD DDFSINFGDY IDMGTSNEEP SADAENDEEL AAFMDPDKMF       480
     GTSK                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page