(data stored in ACNUC9435 zone)

EMBL: CP000904.PE191

CP000904.PE191       Location/Qualifiers
FT   CDS             complement(287834..288571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5650"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: bcz:pE33L466_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5650"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46615"
FT                   /db_xref="GOA:A9VUP4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP4"
FT                   /protein_id="ABY46615.1"
FT                   /translation="MIKQENQSEQTMVDDENSLHEDAFEKAWRITEFSKLVGRHHNTVY
FT                   NWFNTLEEKGLHGTLRTNNTNEKLYNSLDLNIALFIKQKRDEKWSLDAIIELLPHQFEL
FT                   RPVSPENHSNEVLSQIDFQDAAETIEKLVEQKVQAHLQNIEIQFQEKFENVLKALPQPE
FT                   DPIAMKERQRQERLDNIIIEHRARKELRRQAEKLWNEKPEEERVKKVGWFKKEEDLAKK
FT                   HLFIENYLNENMIEYMQSIMTSE"
     MIKQENQSEQ TMVDDENSLH EDAFEKAWRI TEFSKLVGRH HNTVYNWFNT LEEKGLHGTL        60
     RTNNTNEKLY NSLDLNIALF IKQKRDEKWS LDAIIELLPH QFELRPVSPE NHSNEVLSQI       120
     DFQDAAETIE KLVEQKVQAH LQNIEIQFQE KFENVLKALP QPEDPIAMKE RQRQERLDNI       180
     IIEHRARKEL RRQAEKLWNE KPEEERVKKV GWFKKEEDLA KKHLFIENYL NENMIEYMQS       240
     IMTSE                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page