(data stored in ACNUC9435 zone)

EMBL: CP000904.PE192

CP000904.PE192       Location/Qualifiers
FT   CDS             290656..293061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5651"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: btk:BT9727_2889 sensory transduction histidine
FT                   kinase; sporulation kinase A; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5651"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46616"
FT                   /db_xref="GOA:A9VUP5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP5"
FT                   /protein_id="ABY46616.1"
FT                   /translation="MIIKDYFINLSIFSLLVSAAIFIQVFTIHSRRYFEKFYGGIIAVT
FT                   LMFFSFPYMGFSYDLRAVPLILSFIYFGRIAGWITLISIIIMRIFYIGGYWEPPVMAYF
FT                   GMGILFTIFKTYFKSLHPFKSAPLYFSVFVGMKWLVGVFFITTVLYTPGLVFIALGLLI
FT                   GVFLMEAYQRLYYLTQDLSKMNQKLKKSKQELKDTVHELQGGIFKFKKTDKHFIHTLCD
FT                   GQFYYQNGIYSERVVGKSLRTIDASIIPPHLVPQLMKYYLQAWEGKEIIFELPWPNDKT
FT                   IILIALRPIKRNGQVIEVVGSTVDITERKKVESELRATKELLESFIKHNVDAITISDRE
FT                   GHILQANKAYEKIFGWSSHEIIGKRLPCVPDFLMDESLGNIQKILTGESVVTRLETVRQ
FT                   RNDGSLLDVSLTVSPILDVRGNVIALSAICRDISERKQAERERQRLHQQLRDSEMKYRA
FT                   LIEQATDAVYVVELNEDQFPSRFIEVNPVGCNRFGYSREELLSMPFPNNVPQDSPIIIQ
FT                   LLEKIREGQTSFTLQDEHIFPTGKTITTEFSVRIFNLNGKKVFLSISRDITERLKTEEL
FT                   LRKSEKLAVVGQLATAIAHEINNPLTAMKGFMQLLKSTENENNQGYINIVSSEIERIES
FT                   ITNEFMAVAKPQVVRIQPNDISVLTDQVLLILQPQAMMNNIQIRTDYTPGIPLIPCEGN
FT                   QLKQVFVNILKNAIESMPMGGEILIQIDKLDNDQISIRFIDQGCGIPKERIPYLGEPFY
FT                   SIKEEGIGLGLMICYKIIETHQGKVFIESEVNKGTTVEVTLPICTIQK"
     MIIKDYFINL SIFSLLVSAA IFIQVFTIHS RRYFEKFYGG IIAVTLMFFS FPYMGFSYDL        60
     RAVPLILSFI YFGRIAGWIT LISIIIMRIF YIGGYWEPPV MAYFGMGILF TIFKTYFKSL       120
     HPFKSAPLYF SVFVGMKWLV GVFFITTVLY TPGLVFIALG LLIGVFLMEA YQRLYYLTQD       180
     LSKMNQKLKK SKQELKDTVH ELQGGIFKFK KTDKHFIHTL CDGQFYYQNG IYSERVVGKS       240
     LRTIDASIIP PHLVPQLMKY YLQAWEGKEI IFELPWPNDK TIILIALRPI KRNGQVIEVV       300
     GSTVDITERK KVESELRATK ELLESFIKHN VDAITISDRE GHILQANKAY EKIFGWSSHE       360
     IIGKRLPCVP DFLMDESLGN IQKILTGESV VTRLETVRQR NDGSLLDVSL TVSPILDVRG       420
     NVIALSAICR DISERKQAER ERQRLHQQLR DSEMKYRALI EQATDAVYVV ELNEDQFPSR       480
     FIEVNPVGCN RFGYSREELL SMPFPNNVPQ DSPIIIQLLE KIREGQTSFT LQDEHIFPTG       540
     KTITTEFSVR IFNLNGKKVF LSISRDITER LKTEELLRKS EKLAVVGQLA TAIAHEINNP       600
     LTAMKGFMQL LKSTENENNQ GYINIVSSEI ERIESITNEF MAVAKPQVVR IQPNDISVLT       660
     DQVLLILQPQ AMMNNIQIRT DYTPGIPLIP CEGNQLKQVF VNILKNAIES MPMGGEILIQ       720
     IDKLDNDQIS IRFIDQGCGI PKERIPYLGE PFYSIKEEGI GLGLMICYKI IETHQGKVFI       780
     ESEVNKGTTV EVTLPICTIQ K                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page