(data stored in ACNUC9435 zone)

EMBL: CP000904.PE193

CP000904.PE193       Location/Qualifiers
FT   CDS             293937..294845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5653"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   sen:SACE_6215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5653"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46617"
FT                   /db_xref="GOA:A9VUP6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP6"
FT                   /protein_id="ABY46617.1"
FT                   /translation="MKGWIIMSSYFPKVGRLIGVISMLVILLSSFWLIWNGETNIRYSG
FT                   DHEGTMSFGNKWIPVIIGIFLVRFLPFHRKNYNPIQQHEPRHIMIQTFVLFLSGFLFTI
FT                   CLLIANFEGMALQLWFMISKIILLLLTPLMLLLFYQSNPNKERFKPVKSLVSNRWYRLT
FT                   PLMVIIIWGYFNFFSVFSTPFVSIGMDRTILIATLFLGFFINSVLEEIFYRVWLQTRLE
FT                   LLLGTWPAILLTSLLWASWHIAIHGSGHWGTDTATVITNLGIVGLFLGYLWARYRKVWV
FT                   IIIVHGFINAHPQQLLEILFN"
     MKGWIIMSSY FPKVGRLIGV ISMLVILLSS FWLIWNGETN IRYSGDHEGT MSFGNKWIPV        60
     IIGIFLVRFL PFHRKNYNPI QQHEPRHIMI QTFVLFLSGF LFTICLLIAN FEGMALQLWF       120
     MISKIILLLL TPLMLLLFYQ SNPNKERFKP VKSLVSNRWY RLTPLMVIII WGYFNFFSVF       180
     STPFVSIGMD RTILIATLFL GFFINSVLEE IFYRVWLQTR LELLLGTWPA ILLTSLLWAS       240
     WHIAIHGSGH WGTDTATVIT NLGIVGLFLG YLWARYRKVW VIIIVHGFIN AHPQQLLEIL       300
     FN                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page