(data stored in ACNUC9435 zone)

EMBL: CP000904.PE195

CP000904.PE195       Location/Qualifiers
FT   CDS             296827..299463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5655"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="PFAM: peptidase domain protein; Peptidase M9A
FT                   collagenase domain protein; Peptidase M9 domain; KEGG:
FT                   btk:BT9727_3286 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5655"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46619"
FT                   /db_xref="GOA:A9VUP8"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP8"
FT                   /protein_id="ABY46619.1"
FT                   /translation="MVKYSRISKLIVGVGLVTISCSGLQIQAETKEKNVKNVLQMEPVG
FT                   LRKSVDELAHPSNVQENGSFTKRLKLADLSQRPPMPNENAKQLVEEKKYSMAELNQLSN
FT                   KQLTDLLVTIQWYQIPELFQFNNDSLKFYQDDSRMQAIIAKLAEQGQAYTKDDSKGIET
FT                   LVEVLRSGFYLGFYHQELSKLSERVYHDKCLPALKTIAKNPNFKLGTTEQNKVISSYGM
FT                   LIGGASADVEVIQYAGEIFKQYNDNLSTFIEDRTKGDAVYNLMKEVDYEVQSYMNATGK
FT                   EPKDMLWYGKIDGFINEINRFALIGTVTDKNGWLINNGIYYASRFGKFYSTPTKGQQVV
FT                   TEAMGIYPYLGQQYFAAAEQIATNYGGIDANGKTVNLDQIREDGKKHYLPKTYTFDDGA
FT                   IVFKAGDKVSEEKIKRLYWAAKEVRSQYYRTVGSDKPLESGHADDVLTMVIYNSPDEYQ
FT                   FNRQLYGYETNNGGIYIEGTGTFFTYERTPQQSIYSLEELFRHEFTHYLQGRYEVPGLW
FT                   GQGEMYQNERLTWFEEGNAEFFAGSTRLDSVVPRKSIIGGLSNDPSKRYTAAQTLNAKY
FT                   GTWDFYNYSFALQSYMYNNRPDMFDKVHDLIRTNDVPGYDAYRSTLSKDNKLNEEYQTY
FT                   MQMLIDNRDKYTIPQVSDDYVAQHNPKPLSDVASDITNEAKLKNVKVTKNKSQFFNTFT
FT                   LQGTYTGSAAKGENEDWKVMNQATNDMLKHLAEKEWSGYKTLNAYFVNYRVNAAGQFEY
FT                   DVVFSGVNTEEGTAVEKEPNNSFDAANPLSLNALLRGNLSDQDQVDRFVIDVKDPKDLQ
FT                   ITVTNEQNLGLNWVLYSESDLNNYVTYATKRDGNKLLGNYNAKPGKYYLSVYKYGGGTG
FT                   NFTVEVK"
     MVKYSRISKL IVGVGLVTIS CSGLQIQAET KEKNVKNVLQ MEPVGLRKSV DELAHPSNVQ        60
     ENGSFTKRLK LADLSQRPPM PNENAKQLVE EKKYSMAELN QLSNKQLTDL LVTIQWYQIP       120
     ELFQFNNDSL KFYQDDSRMQ AIIAKLAEQG QAYTKDDSKG IETLVEVLRS GFYLGFYHQE       180
     LSKLSERVYH DKCLPALKTI AKNPNFKLGT TEQNKVISSY GMLIGGASAD VEVIQYAGEI       240
     FKQYNDNLST FIEDRTKGDA VYNLMKEVDY EVQSYMNATG KEPKDMLWYG KIDGFINEIN       300
     RFALIGTVTD KNGWLINNGI YYASRFGKFY STPTKGQQVV TEAMGIYPYL GQQYFAAAEQ       360
     IATNYGGIDA NGKTVNLDQI REDGKKHYLP KTYTFDDGAI VFKAGDKVSE EKIKRLYWAA       420
     KEVRSQYYRT VGSDKPLESG HADDVLTMVI YNSPDEYQFN RQLYGYETNN GGIYIEGTGT       480
     FFTYERTPQQ SIYSLEELFR HEFTHYLQGR YEVPGLWGQG EMYQNERLTW FEEGNAEFFA       540
     GSTRLDSVVP RKSIIGGLSN DPSKRYTAAQ TLNAKYGTWD FYNYSFALQS YMYNNRPDMF       600
     DKVHDLIRTN DVPGYDAYRS TLSKDNKLNE EYQTYMQMLI DNRDKYTIPQ VSDDYVAQHN       660
     PKPLSDVASD ITNEAKLKNV KVTKNKSQFF NTFTLQGTYT GSAAKGENED WKVMNQATND       720
     MLKHLAEKEW SGYKTLNAYF VNYRVNAAGQ FEYDVVFSGV NTEEGTAVEK EPNNSFDAAN       780
     PLSLNALLRG NLSDQDQVDR FVIDVKDPKD LQITVTNEQN LGLNWVLYSE SDLNNYVTYA       840
     TKRDGNKLLG NYNAKPGKYY LSVYKYGGGT GNFTVEVK                               878
//

If you have problems or comments...

PBIL Back to PBIL home page