(data stored in ACNUC9435 zone)

EMBL: CP000904.PE196

CP000904.PE196       Location/Qualifiers
FT   CDS             300541..301248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5656"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5656"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46620"
FT                   /db_xref="GOA:A9VUP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP9"
FT                   /protein_id="ABY46620.1"
FT                   /translation="MEKENLFKWKHYQPELILLTVRWYLRYNLSFRNLVEMMEERGLSI
FT                   AHTTIMRWVHQYGPQLEEKVRHHLKSTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FHLSKSRDKQAAKCFFKKALAFSYVSKPRVITVDKNPAYPVAIQALKEEKHMPEGIKLR
FT                   QVRYLNNIVEQDHRFIKKRVRSMLGFKSFGTATSILAGVEAMHMIKKEQIDLRDQSVQN
FT                   QKEFIHQLFGLTA"
     MEKENLFKWK HYQPELILLT VRWYLRYNLS FRNLVEMMEE RGLSIAHTTI MRWVHQYGPQ        60
     LEEKVRHHLK STNDSWRVDE TYIKVKGQWM YLYRAVDSKG NTIDFHLSKS RDKQAAKCFF       120
     KKALAFSYVS KPRVITVDKN PAYPVAIQAL KEEKHMPEGI KLRQVRYLNN IVEQDHRFIK       180
     KRVRSMLGFK SFGTATSILA GVEAMHMIKK EQIDLRDQSV QNQKEFIHQL FGLTA            235
//

If you have problems or comments...

PBIL Back to PBIL home page