(data stored in ACNUC9435 zone)

EMBL: CP000904.PE197

CP000904.PE197       Location/Qualifiers
FT   CDS             complement(301343..301573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5657"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bcz:pE33L54_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5657"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46621"
FT                   /db_xref="GOA:A9VUQ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ0"
FT                   /protein_id="ABY46621.1"
FT                   /translation="MFWKFGGKNRTKLGDFLDRNGFTQNDLEKTAKLSRPTVSKACNDK
FT                   EYIPSPTVMKKILKVIRQIKPNVKSTDFWDM"
     MFWKFGGKNR TKLGDFLDRN GFTQNDLEKT AKLSRPTVSK ACNDKEYIPS PTVMKKILKV        60
     IRQIKPNVKS TDFWDM                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page