(data stored in ACNUC9435 zone)

EMBL: CP000904.PE198

CP000904.PE198       Location/Qualifiers
FT   CDS             301865..302185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5658"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46622"
FT                   /db_xref="GOA:A9VUQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ1"
FT                   /protein_id="ABY46622.1"
FT                   /translation="MRARKETIPFREFMDRSYKDKEQKIRKYNSLSPFAFLHMSDQVLH
FT                   TYIALGVMGTILIGAVMLEKYLVRHDYISAAKFVSEGIYHGTRIGGVCLIGYVFVRIVI
FT                   MF"
     MRARKETIPF REFMDRSYKD KEQKIRKYNS LSPFAFLHMS DQVLHTYIAL GVMGTILIGA        60
     VMLEKYLVRH DYISAAKFVS EGIYHGTRIG GVCLIGYVFV RIVIMF                      106
//

If you have problems or comments...

PBIL Back to PBIL home page