(data stored in ACNUC9435 zone)

EMBL: CP000904.PE2

CP000904.PE2         Location/Qualifiers
FT   CDS             1615..2730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46426"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ4"
FT                   /protein_id="ABY46426.1"
FT                   /translation="MAETGSVQNAVGNNIYPDLVLTRFPELFDERSGSKSNPNLQRWTN
FT                   LKDYNMAEHVNSLQDATMAIQRMLGELAQMPAAPKDANGKPITDPNVLLNLKRTSTVKS
FT                   RIDALETHDWYAEFDKRYGGPVWKFDKDKPTNPTIQQHRHLGSASGIPGMPEKIVLTEE
FT                   VQGKLPKANVDLTKTATGITGSDIYVESTSNTKVSDAINDKISETTGGTIAQNAELEVL
FT                   GKTNTRWTREFDSNDASSTGNTAVADGKTLLNKAIESGATAASDLLNAPLDGMHYGRYV
FT                   AIVRLSASSLPSNGLVEISAVNSKTNQVINKTTLNGTDFDTSGQYKTFYLIFNHDGSTK
FT                   IRVRKLATTSSVKVRFDYAIVEPVHPAVFDR"
     MAETGSVQNA VGNNIYPDLV LTRFPELFDE RSGSKSNPNL QRWTNLKDYN MAEHVNSLQD        60
     ATMAIQRMLG ELAQMPAAPK DANGKPITDP NVLLNLKRTS TVKSRIDALE THDWYAEFDK       120
     RYGGPVWKFD KDKPTNPTIQ QHRHLGSASG IPGMPEKIVL TEEVQGKLPK ANVDLTKTAT       180
     GITGSDIYVE STSNTKVSDA INDKISETTG GTIAQNAELE VLGKTNTRWT REFDSNDASS       240
     TGNTAVADGK TLLNKAIESG ATAASDLLNA PLDGMHYGRY VAIVRLSASS LPSNGLVEIS       300
     AVNSKTNQVI NKTTLNGTDF DTSGQYKTFY LIFNHDGSTK IRVRKLATTS SVKVRFDYAI       360
     VEPVHPAVFD R                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page