(data stored in ACNUC9435 zone)

EMBL: CP000904.PE20

CP000904.PE20        Location/Qualifiers
FT   CDS             39615..40862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46444"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV12"
FT                   /protein_id="ABY46444.1"
FT                   /translation="MRPITLRNPNLNKGPSSSEEFNKLRNDIQTDITNLFDIVNSHDGI
FT                   ISENMDHILRENYFLQNRLKKLEGRVYELEKDYQNNSVDGESILTRSFYHASNIISSNA
FT                   NNPINIDTLHGIVTPVVVRSHDKIAYKNDLGEYILPSNLEASVFESSDVEPIDEETKQR
FT                   KFYAVNSSGITKAFDGDKNSFWVRQSESNENKCVTEVYGLIHVKIPQNISNNIYTNTIT
FT                   IHPSPEYSMSILDIQYKNQNGEWRRIETYPIKKVNNTDIPEEIVESGKLVFSFPRRQVT
FT                   ELQIKVKQPYWFKHDNKRIFMYGFQDIVVEYREYSQDTSEFTTKFSLEGTDRRFTNVNT
FT                   PKVTVPVGCPSLNDYTVKHELYFDEGLTEKFDFSTDIFQPIQTVYVKTLLKTAGDQVPI
FT                   LREIELPYRHEELEVL"
     MRPITLRNPN LNKGPSSSEE FNKLRNDIQT DITNLFDIVN SHDGIISENM DHILRENYFL        60
     QNRLKKLEGR VYELEKDYQN NSVDGESILT RSFYHASNII SSNANNPINI DTLHGIVTPV       120
     VVRSHDKIAY KNDLGEYILP SNLEASVFES SDVEPIDEET KQRKFYAVNS SGITKAFDGD       180
     KNSFWVRQSE SNENKCVTEV YGLIHVKIPQ NISNNIYTNT ITIHPSPEYS MSILDIQYKN       240
     QNGEWRRIET YPIKKVNNTD IPEEIVESGK LVFSFPRRQV TELQIKVKQP YWFKHDNKRI       300
     FMYGFQDIVV EYREYSQDTS EFTTKFSLEG TDRRFTNVNT PKVTVPVGCP SLNDYTVKHE       360
     LYFDEGLTEK FDFSTDIFQP IQTVYVKTLL KTAGDQVPIL REIELPYRHE ELEVL            415
//

If you have problems or comments...

PBIL Back to PBIL home page