(data stored in ACNUC9435 zone)

EMBL: CP000904.PE200

CP000904.PE200       Location/Qualifiers
FT   CDS             303354..303965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5660"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5660"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46624"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ3"
FT                   /protein_id="ABY46624.1"
FT                   /translation="MMKSRDKGILNDLNRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKR
FT                   LRRDGYVDANVLQHPYIYFPQPSSIRKTSQKIPHFLGIVDVYKQLVHYENPKLFEVEPK
FT                   YRKEYMEPDAFTIWRRSPFFIEVQKSVYSKKLMQDKINRYELYFHNQEWHNEYWQPKAS
FT                   KFFPSILIITDKHYDVQSPYFRIFQANSIESFMNNLTVKS"
     MMKSRDKGIL NDLNRFRCMS RDDIIDLHFQ GLKNAVTCCN TVMKRLRRDG YVDANVLQHP        60
     YIYFPQPSSI RKTSQKIPHF LGIVDVYKQL VHYENPKLFE VEPKYRKEYM EPDAFTIWRR       120
     SPFFIEVQKS VYSKKLMQDK INRYELYFHN QEWHNEYWQP KASKFFPSIL IITDKHYDVQ       180
     SPYFRIFQAN SIESFMNNLT VKS                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page