(data stored in ACNUC9435 zone)

EMBL: CP000904.PE201

CP000904.PE201       Location/Qualifiers
FT   CDS             304362..305009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5662"
FT                   /product="antigen"
FT                   /note="KEGG: bce:BC2461 antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5662"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46625"
FT                   /db_xref="GOA:A9VUQ4"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ4"
FT                   /protein_id="ABY46625.1"
FT                   /translation="MKNTSKKQIIILFFISILGLGTMLGILYFNHKTNIQQNKALATEK
FT                   RVLQYEPTLKKELEKYNLGGKTAVLLGIMYQESRGEGNDPMQSSESLGLKPNEIQETSL
FT                   SIKQGVKHFAKMYKYGTEKDVSMDTIIQSYNMGPGYIDFIASQEVKQHSEDSAKKFSKM
FT                   KVNQNPAMYTCGGNKNNFRYPYCYGDFTYATKVNEKTILIEELLRNVHDSSK"
     MKNTSKKQII ILFFISILGL GTMLGILYFN HKTNIQQNKA LATEKRVLQY EPTLKKELEK        60
     YNLGGKTAVL LGIMYQESRG EGNDPMQSSE SLGLKPNEIQ ETSLSIKQGV KHFAKMYKYG       120
     TEKDVSMDTI IQSYNMGPGY IDFIASQEVK QHSEDSAKKF SKMKVNQNPA MYTCGGNKNN       180
     FRYPYCYGDF TYATKVNEKT ILIEELLRNV HDSSK                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page