(data stored in ACNUC9435 zone)

EMBL: CP000904.PE202

CP000904.PE202       Location/Qualifiers
FT   CDS             complement(305092..305799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5663"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5663"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46626"
FT                   /db_xref="GOA:A9VUQ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ5"
FT                   /protein_id="ABY46626.1"
FT                   /translation="MEKEYVFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRSHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHFFKKALQSFHVSKPPVITVDKNPAYPIAIEQLKKEKSIPGGMRLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
     MEKEYVFKWK HYQPDIILLT VRWYLRYNLS FRDLVEMMEE RGLSISHTTI MRWVHQYGPE        60
     LDKRIRSHLK QTNDSWRVDE TYIKVKGQWM YLYRAVDSKG NTIDFYLSKT RDQKAAKHFF       120
     KKALQSFHVS KPPVITVDKN PAYPIAIEQL KKEKSIPGGM RLRQQKYLNN IVEQDHRFIK       180
     KRIRSMLGFK CFDTATSILS GVEVMHMIKK EQVDLRDQSV QNQKEFIHQL FGLAA            235
//

If you have problems or comments...

PBIL Back to PBIL home page