(data stored in ACNUC9435 zone)

EMBL: CP000904.PE203

CP000904.PE203       Location/Qualifiers
FT   CDS             complement(306853..308562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BXA0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5664"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46627"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ6"
FT                   /protein_id="ABY46627.1"
FT                   /translation="MGKSFIIQNQRSLNGETTNAVLVTLKSWQKFVEAFEKKYYSYKDT
FT                   YLEDILQHMTYEERIADVEGFVEQAKPSFSRRAMSALAEKTGRKHKLYGITNADLEVFL
FT                   YLHKKCYTNGVIPNVTIHMMWEDYKQYKEEFAHIQHSQFYIALKKLSIHNIIAIENGVD
FT                   GRYTIKLTHFMNEETEKTNPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKR
FT                   SLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTENPLFKICKMQKGVKH
FT                   TKRYTTLYLSIHSDFLCTKESGEEQHRDPFTPKATYARKAKFIESVLQEMNIGELSSDM
FT                   NKFIHVLKHTCHRQIRGVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKE
FT                   GIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHSIKKMFKNVHALLKQKFAVPVTEE
FT                   SYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFI
FT                   EAIDKLPQEKLRVIELPKQFNLLEFMRTFEHLIRAGATITAPDQVLSAMEIK"
     MGKSFIIQNQ RSLNGETTNA VLVTLKSWQK FVEAFEKKYY SYKDTYLEDI LQHMTYEERI        60
     ADVEGFVEQA KPSFSRRAMS ALAEKTGRKH KLYGITNADL EVFLYLHKKC YTNGVIPNVT       120
     IHMMWEDYKQ YKEEFAHIQH SQFYIALKKL SIHNIIAIEN GVDGRYTIKL THFMNEETEK       180
     TNPYVYISPV VFTKAFFKLS VAAKKLFLDI AMQQHTETTL KRSLDKQDER GNKTHFGGMY       240
     RFLHKKYPHQ IRAVIEELTT ALPCTENPLF KICKMQKGVK HTKRYTTLYL SIHSDFLCTK       300
     ESGEEQHRDP FTPKATYARK AKFIESVLQE MNIGELSSDM NKFIHVLKHT CHRQIRGVIR       360
     GLRDMVDRKE GYPTKIVYTL KKLLHQTSQY QILDTAAKEG IYPLIAQHIP KERNSDREQA       420
     VFNFGLHYSM YSLHSIKKMF KNVHALLKQK FAVPVTEESY HRNYLKYQEE TLFRKYAYDQ       480
     GVNLHAYIAL EIEMREKLKV RGHKERTIPS DVREWFIEAI DKLPQEKLRV IELPKQFNLL       540
     EFMRTFEHLI RAGATITAPD QVLSAMEIK                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page