(data stored in ACNUC9435 zone)

EMBL: CP000904.PE205

CP000904.PE205       Location/Qualifiers
FT   CDS             311718..312194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5666"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5666"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46629"
FT                   /db_xref="GOA:A9VUQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ8"
FT                   /protein_id="ABY46629.1"
FT                   /translation="MKLNNWDEISIEKSTNIGKEEMELLLLADPSPEVVNGYLKQGDCF
FT                   VLKKDAITVGIMILIPTRPETIEIINIAVSEKEQGKGYGKYLLGFAIDYAKKEKYKTIE
FT                   IGTGNSSLMQLGLYQKCGFRITNVDRDFFLRNYEEEIYENGIQCIDMIRLTQYL"
     MKLNNWDEIS IEKSTNIGKE EMELLLLADP SPEVVNGYLK QGDCFVLKKD AITVGIMILI        60
     PTRPETIEII NIAVSEKEQG KGYGKYLLGF AIDYAKKEKY KTIEIGTGNS SLMQLGLYQK       120
     CGFRITNVDR DFFLRNYEEE IYENGIQCID MIRLTQYL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page