(data stored in ACNUC9435 zone)

EMBL: CP000904.PE206

CP000904.PE206       Location/Qualifiers
FT   CDS             312921..314249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5667"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   bay:RBAM_031240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5667"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46630"
FT                   /db_xref="GOA:A9VUQ9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ9"
FT                   /protein_id="ABY46630.1"
FT                   /translation="MVTVLNNEIKKTLVEKIVNKSACIGYIGLGYVGLPSALKCLEVGY
FT                   TVRGFDKNLTKIEKLECGTSYISDIQDTEIQDALHTNRFFISTEMNYINECDVVVICVP
FT                   TPLEKDSKQPDLTYIHSAVNELVKYIRKGTLIILESTTYPGTTREEILYKLEHETNFEI
FT                   GTDIFVAYSPERIDPANKSFSIQDIIKIVGGVTPNCTDCAAAFYSHLIKGIHKVSSPEV
FT                   AETAKLLENTYRFINIAFINEMTQICNELNINIWEVIDASGTKPFGFQKFYPGPGVGGH
FT                   CIPIDPIYFKWIANNKDLATKMIDVAQEINENMPNYIIKRALQLLQDEDGKNVLMIGVA
FT                   YKKNVNDARESSALDIMNGLMLEGYNVDYHDPFIEELIVDNHKVKKSINLTTNALNKYH
FT                   LIIVHTDHDCINFNLLNGVNCLILDTRNILKDQSIYKKNIICL"
     MVTVLNNEIK KTLVEKIVNK SACIGYIGLG YVGLPSALKC LEVGYTVRGF DKNLTKIEKL        60
     ECGTSYISDI QDTEIQDALH TNRFFISTEM NYINECDVVV ICVPTPLEKD SKQPDLTYIH       120
     SAVNELVKYI RKGTLIILES TTYPGTTREE ILYKLEHETN FEIGTDIFVA YSPERIDPAN       180
     KSFSIQDIIK IVGGVTPNCT DCAAAFYSHL IKGIHKVSSP EVAETAKLLE NTYRFINIAF       240
     INEMTQICNE LNINIWEVID ASGTKPFGFQ KFYPGPGVGG HCIPIDPIYF KWIANNKDLA       300
     TKMIDVAQEI NENMPNYIIK RALQLLQDED GKNVLMIGVA YKKNVNDARE SSALDIMNGL       360
     MLEGYNVDYH DPFIEELIVD NHKVKKSINL TTNALNKYHL IIVHTDHDCI NFNLLNGVNC       420
     LILDTRNILK DQSIYKKNII CL                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page