(data stored in ACNUC9435 zone)

EMBL: CP000904.PE207

CP000904.PE207       Location/Qualifiers
FT   CDS             314258..315415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5668"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class-III; KEGG: bay:RBAM_031230
FT                   SpsC1"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5668"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46631"
FT                   /db_xref="GOA:A9VUR0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR0"
FT                   /protein_id="ABY46631.1"
FT                   /translation="MVEFIPFYRPEINDEDVEGVIRALKSGWLSKGPKVIEFEESLKEY
FT                   LNTGHVVSCNSGTAALHLALLSLGIGVEDEVIVPSFTFCSSVNVIMHVGAKPVFVDIDE
FT                   EDLCLDLHDVKRKITKKTKAIIAVHFAGYPAKLQELQKLCKEHGLFLIEDAAHALGTKY
FT                   DNTLIGTHGDIICFSFYATKNITTGEGGALVTKNEEIAEKARLYGWHGITKNAWNRYGE
FT                   KGSWRYDVLLPGFKYNMMDLQASLGISQLKRADEMIEKRRRIAEIYQKELKEIQEYITL
FT                   PNYVNNPSIKHAWHLFVIKINPNSPISRDQMIQEMKKRNIGLSVHFIPVHMHPYYQERF
FT                   NVHLPKTEEVFDQIISLPLYSALTENEVEHIVTSLKSLYQLKVGR"
     MVEFIPFYRP EINDEDVEGV IRALKSGWLS KGPKVIEFEE SLKEYLNTGH VVSCNSGTAA        60
     LHLALLSLGI GVEDEVIVPS FTFCSSVNVI MHVGAKPVFV DIDEEDLCLD LHDVKRKITK       120
     KTKAIIAVHF AGYPAKLQEL QKLCKEHGLF LIEDAAHALG TKYDNTLIGT HGDIICFSFY       180
     ATKNITTGEG GALVTKNEEI AEKARLYGWH GITKNAWNRY GEKGSWRYDV LLPGFKYNMM       240
     DLQASLGISQ LKRADEMIEK RRRIAEIYQK ELKEIQEYIT LPNYVNNPSI KHAWHLFVIK       300
     INPNSPISRD QMIQEMKKRN IGLSVHFIPV HMHPYYQERF NVHLPKTEEV FDQIISLPLY       360
     SALTENEVEH IVTSLKSLYQ LKVGR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page