(data stored in ACNUC9435 zone)

EMBL: CP000904.PE208

CP000904.PE208       Location/Qualifiers
FT   CDS             315422..316345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5669"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: bay:RBAM_031220
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5669"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46632"
FT                   /db_xref="GOA:A9VUR1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR1"
FT                   /protein_id="ABY46632.1"
FT                   /translation="MKIGVIGGGGFIGKHVTKELIARGYEVIIFDKFKPSMDVPFEEID
FT                   ILDIATLREKLINVDGVIHLAALVGVDNCRSNEEDVVRVNFEGTKNIVEVCIENGIGKL
FT                   LFSSSSEVYGDGVSVPFKENDVKIPKSAYGKAKLMSEDFLKEYANNSFKVRVVRYFNVY
FT                   GSQQNENFVISKFLKQAHNGENMTIYGDGQQIRCFSYISDIVNGTILAFEYERENFADF
FT                   NIGNNKPISMEELAGKINELMGNKSEIEFLNLGDEGVRDSNIEIFRRIPSIEKAQLLLN
FT                   YQPVISLNRGLEKIIEEKYGNTVSIS"
     MKIGVIGGGG FIGKHVTKEL IARGYEVIIF DKFKPSMDVP FEEIDILDIA TLREKLINVD        60
     GVIHLAALVG VDNCRSNEED VVRVNFEGTK NIVEVCIENG IGKLLFSSSS EVYGDGVSVP       120
     FKENDVKIPK SAYGKAKLMS EDFLKEYANN SFKVRVVRYF NVYGSQQNEN FVISKFLKQA       180
     HNGENMTIYG DGQQIRCFSY ISDIVNGTIL AFEYERENFA DFNIGNNKPI SMEELAGKIN       240
     ELMGNKSEIE FLNLGDEGVR DSNIEIFRRI PSIEKAQLLL NYQPVISLNR GLEKIIEEKY       300
     GNTVSIS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page