(data stored in ACNUC9435 zone)

EMBL: CP000904.PE209

CP000904.PE209       Location/Qualifiers
FT   CDS             316320..317561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5670"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   bay:RBAM_031210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5670"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46633"
FT                   /db_xref="GOA:A9VUR2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR2"
FT                   /protein_id="ABY46633.1"
FT                   /translation="METQYLYPKNPKKIKYPIYPSFWSVFDHIYFLKSIYRSNHSNLKE
FT                   SLQTLYPNSEIILTNSGSSALVAGLKYLNIKKEDEVILSNFNCPNVIEAVLTVGAKPVL
FT                   IDLTTDYSLSLNKIKKYSNENTRAIILTHVYGCHEDLEVINWARDNDIYIIDDAAQAMF
FT                   SYQNEKSIGSLGDIGILSFGGTKPIPSIGGGALLLNRTVNDLCDMDEEKKAEVFLDYKN
FT                   HLKTQLALRIKKNRLLSLFTDYWEKLGILPSYNDSKLDSLPEETEVIYPKTMSTLRSLL
FT                   IDRHLKRMKKILEINIYNASLCYTMLQSIEEKYGVKIIFSAQNVYLNYFTIIFKEPSDR
FT                   YECSVYLAGKGIQTCWNYLPLSEIPIFSKYATESENIEFLWSRVLSIPFKYPLRKKDLK
FT                   YICSQILIYLEKKK"
     METQYLYPKN PKKIKYPIYP SFWSVFDHIY FLKSIYRSNH SNLKESLQTL YPNSEIILTN        60
     SGSSALVAGL KYLNIKKEDE VILSNFNCPN VIEAVLTVGA KPVLIDLTTD YSLSLNKIKK       120
     YSNENTRAII LTHVYGCHED LEVINWARDN DIYIIDDAAQ AMFSYQNEKS IGSLGDIGIL       180
     SFGGTKPIPS IGGGALLLNR TVNDLCDMDE EKKAEVFLDY KNHLKTQLAL RIKKNRLLSL       240
     FTDYWEKLGI LPSYNDSKLD SLPEETEVIY PKTMSTLRSL LIDRHLKRMK KILEINIYNA       300
     SLCYTMLQSI EEKYGVKIIF SAQNVYLNYF TIIFKEPSDR YECSVYLAGK GIQTCWNYLP       360
     LSEIPIFSKY ATESENIEFL WSRVLSIPFK YPLRKKDLKY ICSQILIYLE KKK              413
//

If you have problems or comments...

PBIL Back to PBIL home page