(data stored in ACNUC9435 zone)

EMBL: CP000904.PE21

CP000904.PE21        Location/Qualifiers
FT   CDS             42449..42820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46445"
FT                   /db_xref="GOA:A9VV13"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV13"
FT                   /protein_id="ABY46445.1"
FT                   /translation="MEESKKKGEEINDKYPHYKDVNEDALTVSLEQYDQIKVGISVDKV
FT                   IEVAGYPIFSETTKLFSIFGYLGHGGEGSMTITFDNYLYKVSLFFVLGICFFRLMAAWC
FT                   YSFKYSKGYYNEIFTSISL"
     MEESKKKGEE INDKYPHYKD VNEDALTVSL EQYDQIKVGI SVDKVIEVAG YPIFSETTKL        60
     FSIFGYLGHG GEGSMTITFD NYLYKVSLFF VLGICFFRLM AAWCYSFKYS KGYYNEIFTS       120
     ISL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page