(data stored in ACNUC9435 zone)

EMBL: CP000904.PE210

CP000904.PE210       Location/Qualifiers
FT   CDS             317573..318454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5671"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5671"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46634"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR3"
FT                   /protein_id="ABY46634.1"
FT                   /translation="MEIEICTDAQYWDACMEEYNGSVFHCYEWGKLMELLPGVQFFPVL
FT                   IKTRDTVVLSPIYVQDGRVLGSLIGYGGPVIIGQDKIDFAFYESIINRKFENKIQKLLL
FT                   PITINPFQSYSDEKWEYKETYMLDLPNNFEDLWTSCSGKARTSVRYARKQNVEIRPIAL
FT                   EELDEFYNLYQEHNNSIGASYSFSREFFYYLFINLKERILFLGAFLEEELISSSIFIMD
FT                   KQVLYYWININNIKGKNTQSSYLLLNVAFELAIHNKLKYADLGYSHNKGIARPKIYWGA
FT                   VLKKCFCLKERI"
     MEIEICTDAQ YWDACMEEYN GSVFHCYEWG KLMELLPGVQ FFPVLIKTRD TVVLSPIYVQ        60
     DGRVLGSLIG YGGPVIIGQD KIDFAFYESI INRKFENKIQ KLLLPITINP FQSYSDEKWE       120
     YKETYMLDLP NNFEDLWTSC SGKARTSVRY ARKQNVEIRP IALEELDEFY NLYQEHNNSI       180
     GASYSFSREF FYYLFINLKE RILFLGAFLE EELISSSIFI MDKQVLYYWI NINNIKGKNT       240
     QSSYLLLNVA FELAIHNKLK YADLGYSHNK GIARPKIYWG AVLKKCFCLK ERI              293
//

If you have problems or comments...

PBIL Back to PBIL home page