(data stored in ACNUC9435 zone)

EMBL: CP000904.PE211

CP000904.PE211       Location/Qualifiers
FT   CDS             318458..319147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5672"
FT                   /product="WbqC-like family protein"
FT                   /note="PFAM: WbqC-like family protein; KEGG:
FT                   bay:RBAM_031190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5672"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46635"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR4"
FT                   /protein_id="ABY46635.1"
FT                   /translation="MIISGHQPSYLPWYGFFEKIHKSDVFVFHDIAQFEKKGFLNRNRI
FT                   KTSQGVSWLTVPMQMKNYKEIPLNKLKIDNTQDWERKHWKTIRINYSNAPYFNVYKDYL
FT                   ENFYSEKWDNLNSMNMNFIHFIIQELNIDTELYYASELEGITGKKSDFVLELCQKFNAN
FT                   TYYSGSLGQDYLIESDFEHENIEIIYQRIREYSYPQLFGEFIPHLSMLDVLLNCGPEET
FT                   EKLIKGV"
     MIISGHQPSY LPWYGFFEKI HKSDVFVFHD IAQFEKKGFL NRNRIKTSQG VSWLTVPMQM        60
     KNYKEIPLNK LKIDNTQDWE RKHWKTIRIN YSNAPYFNVY KDYLENFYSE KWDNLNSMNM       120
     NFIHFIIQEL NIDTELYYAS ELEGITGKKS DFVLELCQKF NANTYYSGSL GQDYLIESDF       180
     EHENIEIIYQ RIREYSYPQL FGEFIPHLSM LDVLLNCGPE ETEKLIKGV                   229
//

If you have problems or comments...

PBIL Back to PBIL home page