(data stored in ACNUC9435 zone)

EMBL: CP000904.PE212

CP000904.PE212       Location/Qualifiers
FT   CDS             319154..319831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5673"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: bay:RBAM_031180
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5673"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46636"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR5"
FT                   /protein_id="ABY46636.1"
FT                   /translation="MNVLVFAAHPDDEIIGVGGTIAKHVEQGDDVHVVILAEGKSSRSK
FT                   EYRELDLEVKSLSYKETEGACTTLGVTSFARLDFPDNRLDTLPLLDVVKEIEEHINKIN
FT                   PTIIYTQYGGDINIDHTVVYRAVMTATRPLPNSNIKWVFAYETLSSTEWNYNEKDKFLP
FT                   NYFVNIEEHLETKLNAMKHYESELREFPHPRSIEAMKHNAFVWGAKSGYKAAEAFMLVR
FT                   GTW"
     MNVLVFAAHP DDEIIGVGGT IAKHVEQGDD VHVVILAEGK SSRSKEYREL DLEVKSLSYK        60
     ETEGACTTLG VTSFARLDFP DNRLDTLPLL DVVKEIEEHI NKINPTIIYT QYGGDINIDH       120
     TVVYRAVMTA TRPLPNSNIK WVFAYETLSS TEWNYNEKDK FLPNYFVNIE EHLETKLNAM       180
     KHYESELREF PHPRSIEAMK HNAFVWGAKS GYKAAEAFML VRGTW                       225
//

If you have problems or comments...

PBIL Back to PBIL home page