(data stored in ACNUC9435 zone)

EMBL: CP000904.PE213

CP000904.PE213       Location/Qualifiers
FT   CDS             319843..320778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5674"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46637"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR6"
FT                   /protein_id="ABY46637.1"
FT                   /translation="MLIPQVPFFGLDSKQIDLKWVEQGYGLEANIFDGESLHDKSYTTK
FT                   FSDVLSFVQTLNPSLLTLHFPTDNADYLNSEFIKKQLYEFINLAIKYNAAGITVHANQF
FT                   MNIAEFQTYNLIDNRKRIIEFFKMIDEEIKGTNIWIGVENLPIIGNLGDDFDPIFVYPE
FT                   DFNDLVNLDLSNVGITWDICHWSITYLTRLGISKLLRQEEIEYKDFHKYINLMNHIKHL
FT                   HFSSFKHLTIPYSEVRCFEGESPTNGSINEHLLHETLLKVKNQVSSRNIGIVFEVQETD
FT                   YTNRVKSWETLNWFQKNITGIQANSNFLKI"
     MLIPQVPFFG LDSKQIDLKW VEQGYGLEAN IFDGESLHDK SYTTKFSDVL SFVQTLNPSL        60
     LTLHFPTDNA DYLNSEFIKK QLYEFINLAI KYNAAGITVH ANQFMNIAEF QTYNLIDNRK       120
     RIIEFFKMID EEIKGTNIWI GVENLPIIGN LGDDFDPIFV YPEDFNDLVN LDLSNVGITW       180
     DICHWSITYL TRLGISKLLR QEEIEYKDFH KYINLMNHIK HLHFSSFKHL TIPYSEVRCF       240
     EGESPTNGSI NEHLLHETLL KVKNQVSSRN IGIVFEVQET DYTNRVKSWE TLNWFQKNIT       300
     GIQANSNFLK I                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page