(data stored in ACNUC9435 zone)

EMBL: CP000904.PE215

CP000904.PE215       Location/Qualifiers
FT   CDS             322392..323666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5676"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   btk:BT9727_0216 permease; probable multidrug resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5676"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46639"
FT                   /db_xref="GOA:A9VUR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR8"
FT                   /protein_id="ABY46639.1"
FT                   /translation="MRSTWKEFKGMDLNVWIRFIGEALNGIAMMMLMPFFALYLKDKVD
FT                   SLLEVGVIIALSPIAASIGSLIGGHIADTYGRKPTMVLSMASNGLLMLFFLFIDGFIAY
FT                   AILSIGLGLCNSFFEPAASAMVTDVTEPEKRTEAYGLLRMAHNIGAAIGPIIGAAVVVV
FT                   SKDVIFLITSGTMLFYTILMVLFLKETKPKNVMIHEETPENSIRSTLRVVIRDRILLFY
FT                   IVTGIIIFMGFSQSEGMLPLHFSNEKTMIFGNSNPFPYLMTLNGLLVVFFQFPISKWLT
FT                   HKSIGKSMLYGAILFGIGLLAIGWLPKWFQVINTNDLVILVSLLIAYTVYTLGEMIMSP
FT                   VQMTFVANLAPEHLRGTYMGAANLQWITGNILGPLLGGLLLEHLLGHILFTILGVGCVM
FT                   SGFVYLLLDKLVEDRSKQIPIKQTS"
     MRSTWKEFKG MDLNVWIRFI GEALNGIAMM MLMPFFALYL KDKVDSLLEV GVIIALSPIA        60
     ASIGSLIGGH IADTYGRKPT MVLSMASNGL LMLFFLFIDG FIAYAILSIG LGLCNSFFEP       120
     AASAMVTDVT EPEKRTEAYG LLRMAHNIGA AIGPIIGAAV VVVSKDVIFL ITSGTMLFYT       180
     ILMVLFLKET KPKNVMIHEE TPENSIRSTL RVVIRDRILL FYIVTGIIIF MGFSQSEGML       240
     PLHFSNEKTM IFGNSNPFPY LMTLNGLLVV FFQFPISKWL THKSIGKSML YGAILFGIGL       300
     LAIGWLPKWF QVINTNDLVI LVSLLIAYTV YTLGEMIMSP VQMTFVANLA PEHLRGTYMG       360
     AANLQWITGN ILGPLLGGLL LEHLLGHILF TILGVGCVMS GFVYLLLDKL VEDRSKQIPI       420
     KQTS                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page